BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= FWDP01_T7_A06 (845 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value X91618-1|CAA62821.1| 524|Tribolium castaneum hunchback protein. 21 9.3 AM292352-1|CAL23164.1| 250|Tribolium castaneum gustatory recept... 21 9.3 AM292340-1|CAL23152.1| 355|Tribolium castaneum gustatory recept... 21 9.3 >X91618-1|CAA62821.1| 524|Tribolium castaneum hunchback protein. Length = 524 Score = 21.4 bits (43), Expect = 9.3 Identities = 9/26 (34%), Positives = 15/26 (57%) Frame = +3 Query: 447 SQCYQRILS*SSPQCLFRSKLRTRRR 524 SQ R+L S P C + + ++RR+ Sbjct: 394 SQEESRVLDLSKPGCSYTGEQKSRRK 419 >AM292352-1|CAL23164.1| 250|Tribolium castaneum gustatory receptor candidate 31 protein. Length = 250 Score = 21.4 bits (43), Expect = 9.3 Identities = 12/47 (25%), Positives = 22/47 (46%) Frame = +1 Query: 37 NNKYNVDCKQYYSTNKYLIFTKISSYNF*DISHNSYTLKRQLLETFV 177 ++ + D +Q+Y T IFT I I ++ T++ TF+ Sbjct: 59 SSSFEADLRQFYKTAYSAIFTVIDFSLCKAILVHAITIRSTFSWTFI 105 >AM292340-1|CAL23152.1| 355|Tribolium castaneum gustatory receptor candidate 19 protein. Length = 355 Score = 21.4 bits (43), Expect = 9.3 Identities = 5/14 (35%), Positives = 11/14 (78%) Frame = -2 Query: 82 YWCCSIVYNLHYIY 41 ++C SI +N+H ++ Sbjct: 59 FYCVSITFNVHLLF 72 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 170,909 Number of Sequences: 336 Number of extensions: 3364 Number of successful extensions: 3 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 3 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3 length of database: 122,585 effective HSP length: 56 effective length of database: 103,769 effective search space used: 23348025 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -