BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= FWDP01_FL5_P24 (840 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value DQ659247-1|ABG47445.1| 980|Tribolium castaneum chitinase 7 prot... 25 0.99 AF442747-1|AAL40947.1| 669|Tribolium castaneum ABC transmembran... 23 2.3 AF422804-1|AAL56571.1| 669|Tribolium castaneum ABC transmembran... 23 2.3 DQ138190-1|ABA03054.1| 135|Tribolium castaneum bursicon-like pr... 21 9.2 >DQ659247-1|ABG47445.1| 980|Tribolium castaneum chitinase 7 protein. Length = 980 Score = 24.6 bits (51), Expect = 0.99 Identities = 11/28 (39%), Positives = 15/28 (53%) Frame = -2 Query: 617 VLRLPVEGRSFERDAAISHDVFRPMSGG 534 ++ +P GRSFE D+ P SGG Sbjct: 757 MIGMPTYGRSFELVNKTQFDIGAPASGG 784 Score = 22.2 bits (45), Expect = 5.3 Identities = 10/28 (35%), Positives = 13/28 (46%) Frame = -2 Query: 617 VLRLPVEGRSFERDAAISHDVFRPMSGG 534 V+ +P GR+F V P SGG Sbjct: 328 VIGMPTYGRTFTLSNTAKFGVHAPASGG 355 >AF442747-1|AAL40947.1| 669|Tribolium castaneum ABC transmembrane transporter protein. Length = 669 Score = 23.4 bits (48), Expect = 2.3 Identities = 18/51 (35%), Positives = 27/51 (52%), Gaps = 1/51 (1%) Frame = -2 Query: 497 RVHAVISMLGRSIDGQSPHVVKSRIKWQTGAHPQK-HVCAEVITRCPEVIF 348 RV VIS L S +P + RIK +G ++ AEV+T P+++F Sbjct: 193 RVEEVISDLALSKCQNTPIGILGRIKGISGGEKKRLSFAAEVLTN-PKLMF 242 >AF422804-1|AAL56571.1| 669|Tribolium castaneum ABC transmembrane transporter white protein. Length = 669 Score = 23.4 bits (48), Expect = 2.3 Identities = 18/51 (35%), Positives = 27/51 (52%), Gaps = 1/51 (1%) Frame = -2 Query: 497 RVHAVISMLGRSIDGQSPHVVKSRIKWQTGAHPQK-HVCAEVITRCPEVIF 348 RV VIS L S +P + RIK +G ++ AEV+T P+++F Sbjct: 193 RVEEVISDLALSKCQNTPIGILGRIKGISGGEKKRLSFAAEVLTN-PKLMF 242 >DQ138190-1|ABA03054.1| 135|Tribolium castaneum bursicon-like protein protein. Length = 135 Score = 21.4 bits (43), Expect = 9.2 Identities = 11/33 (33%), Positives = 16/33 (48%) Frame = +2 Query: 20 CCVSALLRVTTLIRTLPADPKRIRQYAVLLDIM 118 CC + LR T+ T DP +R A ++ M Sbjct: 83 CCRESFLRERTITLTHCYDPDGVRLTAETVNSM 115 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 178,982 Number of Sequences: 336 Number of extensions: 3668 Number of successful extensions: 10 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 9 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 10 length of database: 122,585 effective HSP length: 56 effective length of database: 103,769 effective search space used: 23140487 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -