BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= FWDP01_FL5_P20 (858 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At3g25250.1 68416.m03154 protein kinase family protein contains ... 29 3.0 At3g19050.1 68416.m02420 kinesin motor protein-related contains ... 28 9.1 >At3g25250.1 68416.m03154 protein kinase family protein contains protein kinase domain, Pfam:PF00069 Length = 421 Score = 29.5 bits (63), Expect = 3.0 Identities = 29/107 (27%), Positives = 52/107 (48%) Frame = -1 Query: 396 NAMSPAESTGLKTNSFVFPETRISRRLILSPGIFFADIVYQLPFL*SDVVLHTIYPEKGS 217 + ++ ++S+G K+NSFV E ++ +I G FA + L + + +L+ P +GS Sbjct: 221 STLAVSDSSGEKSNSFVGTEEYVAPEVISGDGHDFAVDWWSLGVVLYE-MLYGATPFRGS 279 Query: 216 HCNRESPAYDINTSLYQITWPSSQLERYIRSTNTISDPSFGVVINTI 76 NR+ Y I + +T ++ L IR DPS + + I Sbjct: 280 --NRKETFYRILSKPPNLTGETTSLRDLIRRL-LEKDPSRRINVEEI 323 >At3g19050.1 68416.m02420 kinesin motor protein-related contains Pfam profile: PF00225 Kinesin motor domain; contains non-consensus splice site (GC) at intron 12 Length = 2722 Score = 27.9 bits (59), Expect = 9.1 Identities = 15/37 (40%), Positives = 24/37 (64%), Gaps = 2/37 (5%) Frame = +2 Query: 434 TECVSRA--EILRLIYQGSLPAQLGDSGRSRPAPRAH 538 TEC ++ +IL LI QGSL ++G + +R + R+H Sbjct: 363 TECEVQSVQDILGLITQGSLNRRVGATNMNRESSRSH 399 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 17,098,799 Number of Sequences: 28952 Number of extensions: 345382 Number of successful extensions: 834 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 808 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 834 length of database: 12,070,560 effective HSP length: 80 effective length of database: 9,754,400 effective search space used: 1999652000 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -