BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= FWDP01_FL5_P18 (853 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC2F3.10 |||GARP complex subunit Vps54 |Schizosaccharomyces po... 28 1.5 SPAC17H9.01 |cid16||poly|Schizosaccharomyces pombe|chr 1|||Manual 27 4.5 >SPAC2F3.10 |||GARP complex subunit Vps54 |Schizosaccharomyces pombe|chr 1|||Manual Length = 949 Score = 28.3 bits (60), Expect = 1.5 Identities = 13/33 (39%), Positives = 18/33 (54%) Frame = +2 Query: 692 ILYDKVAXVDPVYEPVRSEYRPRPRSIXPLTMI 790 +L D V + PVY P R+E P S P+T + Sbjct: 40 LLEDPVNPIRPVYTPTRTEITPVTLSPIPITPV 72 >SPAC17H9.01 |cid16||poly|Schizosaccharomyces pombe|chr 1|||Manual Length = 1202 Score = 26.6 bits (56), Expect = 4.5 Identities = 13/70 (18%), Positives = 34/70 (48%) Frame = +2 Query: 572 IRSMVTLVIKISHELDERVAYICFRSAEDARDAKHAKPRIILYDKVAXVDPVYEPVRSEY 751 +++++ ++K +L+ V CF S K++ +++Y + P Y+ V+S Sbjct: 904 MKAIIKKLLKSLRKLEGPVKIACFGSYRTGLMTKNSDLDLVIYSSKEALLPYYDRVKSII 963 Query: 752 RPRPRSIXPL 781 + ++ P+ Sbjct: 964 KNEFSNVMPI 973 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,853,194 Number of Sequences: 5004 Number of extensions: 53376 Number of successful extensions: 132 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 130 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 132 length of database: 2,362,478 effective HSP length: 72 effective length of database: 2,002,190 effective search space used: 422462090 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -