BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= FWDP01_FL5_P17 (846 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 09_06_0187 + 21433842-21433887,21434504-21435246,21435437-214354... 30 2.7 03_02_0402 - 8151448-8151669,8151916-8152417,8154537-8155105 29 4.7 12_02_0017 - 12357029-12357070,12357434-12357503,12357722-123578... 29 6.2 08_01_0541 + 4702930-4703328,4703411-4703506,4703601-4703649,470... 29 6.2 06_03_0143 + 17215975-17216745 29 6.2 06_03_0523 - 21734045-21734301,21734452-21734578 28 8.1 >09_06_0187 + 21433842-21433887,21434504-21435246,21435437-21435484, 21435929-21436814,21436967-21437056,21437543-21438417 Length = 895 Score = 29.9 bits (64), Expect = 2.7 Identities = 11/22 (50%), Positives = 16/22 (72%) Frame = +3 Query: 204 FISRMNPYSPELNYFLSYQYCR 269 FI R+ +SP++ YF SY+Y R Sbjct: 190 FIGRLPEWSPDVRYFTSYEYPR 211 >03_02_0402 - 8151448-8151669,8151916-8152417,8154537-8155105 Length = 430 Score = 29.1 bits (62), Expect = 4.7 Identities = 14/41 (34%), Positives = 18/41 (43%) Frame = +1 Query: 703 PFHPRRGNARKPLSLXXXXXAHQITXSSPPPXXSEHXPTHF 825 P H RRG+A + H S PPP E P+H+ Sbjct: 13 PGHRRRGSAAQGHGHHQVHGHHHQPSSPPPPPPPESSPSHY 53 >12_02_0017 - 12357029-12357070,12357434-12357503,12357722-12357852, 12358836-12358882,12359762-12360044,12360547-12362413, 12362454-12362665 Length = 883 Score = 28.7 bits (61), Expect = 6.2 Identities = 11/28 (39%), Positives = 16/28 (57%) Frame = +3 Query: 468 APAQHADDSMDPLDVPQGSTAPQRTARH 551 AP++HA S P P ++AP + RH Sbjct: 79 APSRHATPSSSPPSTPSSASAPPPSGRH 106 >08_01_0541 + 4702930-4703328,4703411-4703506,4703601-4703649, 4703771-4703865 Length = 212 Score = 28.7 bits (61), Expect = 6.2 Identities = 19/60 (31%), Positives = 27/60 (45%) Frame = +3 Query: 423 PFNATFNYMRRLPIDAPAQHADDSMDPLDVPQGSTAPQRTARHGRYSRTEHVMTNGCIAL 602 P +A+ + + L I A A H D LD G +A A H R S+ + T C+ L Sbjct: 84 PASASVSTVADLRILA-ASHLDSLKRRLDALHGDSARDLEASHSRISKRFKMQTQSCLQL 142 >06_03_0143 + 17215975-17216745 Length = 256 Score = 28.7 bits (61), Expect = 6.2 Identities = 15/39 (38%), Positives = 17/39 (43%) Frame = -1 Query: 558 TDHVGRCVVEQCFLVVRLEGPCCHQHAGQEHRWAVSACS 442 T C V C+ VRL P C AG+ R ACS Sbjct: 196 TTAAAACDVPFCYCRVRLRRPACAAPAGRAARRLEKACS 234 >06_03_0523 - 21734045-21734301,21734452-21734578 Length = 127 Score = 28.3 bits (60), Expect = 8.1 Identities = 16/38 (42%), Positives = 20/38 (52%) Frame = +3 Query: 456 LPIDAPAQHADDSMDPLDVPQGSTAPQRTARHGRYSRT 569 LP AP Q A M+PL + + AP R RH R+ T Sbjct: 75 LPTGAPPQPAQ--MEPLGARRRTRAPPRRLRHRRHPLT 110 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 23,161,340 Number of Sequences: 37544 Number of extensions: 508409 Number of successful extensions: 1239 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 1192 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1239 length of database: 14,793,348 effective HSP length: 81 effective length of database: 11,752,284 effective search space used: 2350456800 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -