BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= FWDP01_FL5_P15 (845 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AB264313-1|BAF43600.1| 900|Apis mellifera ecdysone-induced prot... 23 4.7 AB204559-1|BAD89804.1| 832|Apis mellifera soluble guanylyl cycl... 22 6.2 X72577-1|CAA51169.1| 283|Apis mellifera Apidaecin precursor pro... 22 8.2 EF051030-1|ABN05618.1| 118|Apis mellifera phosphoenolpyruvate c... 22 8.2 >AB264313-1|BAF43600.1| 900|Apis mellifera ecdysone-induced protein 75 protein. Length = 900 Score = 22.6 bits (46), Expect = 4.7 Identities = 11/34 (32%), Positives = 14/34 (41%) Frame = -3 Query: 513 PGPTS*CGLLPTFSTSSGEHKTGLLERITQNKPT 412 P P C T + S + GLL+ T N T Sbjct: 745 PSPAEQCASTTTITARSPQGSQGLLQCATSNYST 778 >AB204559-1|BAD89804.1| 832|Apis mellifera soluble guanylyl cyclase beta-3 protein. Length = 832 Score = 22.2 bits (45), Expect = 6.2 Identities = 15/42 (35%), Positives = 21/42 (50%) Frame = +2 Query: 653 RSGSNILHGLLFGRRISTYGSDVVSFTEMEPEERVDPMPXCS 778 R+G N + +S SDVV+FTE+ R+ PM S Sbjct: 408 RNGENPIDTCEMFDSVSILFSDVVTFTEI--CSRITPMEVVS 447 >X72577-1|CAA51169.1| 283|Apis mellifera Apidaecin precursor protein. Length = 283 Score = 21.8 bits (44), Expect = 8.2 Identities = 8/19 (42%), Positives = 11/19 (57%) Frame = +3 Query: 15 PHPTRGRSARPYSRPRPTR 71 PHP R A+P ++P R Sbjct: 251 PHPRLRREAKPEAKPGNNR 269 >EF051030-1|ABN05618.1| 118|Apis mellifera phosphoenolpyruvate carboxykinase protein. Length = 118 Score = 21.8 bits (44), Expect = 8.2 Identities = 7/13 (53%), Positives = 10/13 (76%) Frame = -2 Query: 397 YLTSSCPSTCGPT 359 Y+T++ PS CG T Sbjct: 13 YITAAFPSACGKT 25 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 237,307 Number of Sequences: 438 Number of extensions: 5670 Number of successful extensions: 13 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 13 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 13 length of database: 146,343 effective HSP length: 57 effective length of database: 121,377 effective search space used: 27188448 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -