BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= FWDP01_FL5_P12 (1288 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 10_01_0100 + 1209424-1209538,1210373-1211073,1211158-1211379,121... 38 0.013 01_01_0796 + 6190931-6192745 38 0.013 04_03_0018 - 9434088-9434141,9434211-9434282,9434968-9435062,943... 38 0.017 08_02_0937 + 22801526-22802461 36 0.052 07_03_1136 + 24218601-24218734,24218769-24219906 36 0.069 05_04_0011 + 17139322-17139451,17139552-17140174 36 0.069 02_05_0686 - 30900748-30902167,30903442-30904742 36 0.091 01_01_0892 + 7037384-7037795,7038447-7038962,7039507-7039593,703... 36 0.091 05_07_0200 - 28368890-28369021,28369169-28369303,28369918-283699... 35 0.12 05_02_0081 + 6432957-6433289,6433367-6433882,6434283-6434570 31 0.14 02_04_0180 + 20696258-20698398,20698691-20698871,20698998-20699060 35 0.16 04_03_0243 - 13271384-13272865,13272987-13273248,13274617-13276067 29 0.17 01_06_1670 - 39007402-39008229,39008320-39008567,39009159-390093... 29 0.17 10_06_0008 - 9533424-9533475,9533526-9535344,9535599-9536364,955... 30 0.17 03_02_0071 + 5425722-5427154,5427259-5427464,5428445-5428686,542... 29 0.17 02_03_0279 + 17250347-17252098 29 0.18 11_06_0016 - 19284810-19284926,19285527-19286879 29 0.18 04_04_1027 - 30216859-30217212,30218769-30219178,30219395-30219800 29 0.18 02_04_0567 - 23914330-23914461,23915016-23915136,23915954-239160... 29 0.18 04_01_0197 + 2323790-2324098,2324145-2324774 30 0.18 07_01_0015 + 108338-109186 29 0.18 04_03_1022 - 21778315-21779007 29 0.19 01_06_1321 + 36280691-36281269 29 0.19 06_03_0214 + 18067945-18068463,18068940-18069839,18069918-18070652 34 0.28 10_08_0216 - 15942379-15942852,15942956-15943033 33 0.37 10_06_0039 - 9966744-9967535,9968241-9968482,9969021-9969223,996... 33 0.37 06_03_0729 + 23927656-23927661,23927774-23927923,23928316-239285... 33 0.37 04_03_0660 + 18463011-18463322,18463424-18463516,18464500-184646... 33 0.37 08_01_0375 - 3307206-3307316,3307870-3307965,3308061-3308132,330... 32 0.85 05_07_0031 - 27183252-27183317,27183542-27184282 32 0.85 07_01_0439 + 3333654-3334217 32 1.1 04_04_0137 - 23053148-23053798,23053911-23054146,23054268-230544... 32 1.1 01_01_0715 - 5542648-5543219,5543352-5543544 32 1.1 01_01_0623 + 4672581-4673413,4674274-4674389,4674694-4674902,467... 26 1.3 01_06_0969 - 33472588-33474480,33475543-33475623,33475692-334757... 26 1.4 05_04_0206 + 19034259-19035462,19036870-19037045,19037752-190379... 29 1.4 07_03_0435 + 18182657-18183509,18184477-18184574,18184663-181848... 26 1.4 08_01_0207 - 1647168-1647251,1647583-1647726,1648176-1648287,164... 26 1.4 09_03_0145 - 12749288-12751510 26 1.4 01_07_0021 - 40533864-40534583,40534779-40534814,40534909-405350... 26 1.4 10_08_0534 + 18595520-18595828,18595917-18597149 29 1.4 12_01_0252 + 1868670-1869200,1870167-1871120 31 1.5 06_02_0175 - 12624608-12625297 31 1.5 06_01_0760 - 5676973-5677830 31 1.5 03_02_0436 + 8427018-8427707,8429005-8429544 31 1.5 02_04_0271 + 21445113-21445865,21446727-21446788,21446927-214470... 31 1.5 01_05_0490 + 22672241-22674679 31 1.5 09_06_0277 - 21983049-21983080,21983250-21984788,21986619-219866... 26 1.8 03_05_0865 - 28365430-28367640 26 1.8 01_05_0329 - 21037980-21038378,21038517-21038737,21038827-210389... 26 1.8 07_01_1207 + 11511754-11513865 26 1.8 03_04_0042 - 16743440-16743454,16743907-16744002,16744257-167444... 29 2.0 12_02_0299 - 17051570-17052474,17053542-17053755 31 2.0 09_02_0327 - 7284829-7284889,7284946-7286126 31 2.0 07_01_0674 + 5047503-5047646,5047808-5047901,5048743-5048828,504... 31 2.0 06_01_0690 + 5033943-5034740 31 2.0 05_01_0384 + 2997465-2999777,2999960-3000035,3003027-3003102,300... 31 2.0 02_05_0002 - 24849189-24849825,24850267-24850328 29 2.0 08_01_0539 + 4679392-4681282,4682060-4682104,4682403-4683560,468... 29 2.2 07_01_0516 - 3850252-3852870 29 2.3 07_01_1123 - 10385215-10385574,10385676-10385810,10386385-103870... 29 2.4 01_05_0307 - 20701860-20702168,20702291-20703083,20703183-207032... 25 2.5 06_01_0835 - 6315762-6316844 25 2.5 12_01_0838 - 7830944-7831444 31 2.6 12_01_0347 + 2658545-2659309 31 2.6 07_03_0792 - 21541301-21542143,21542426-21542661,21543177-215433... 31 2.6 07_03_0177 - 14770777-14772045 31 2.6 06_03_0790 - 24636805-24637770 31 2.6 02_04_0400 - 22608519-22608844,22609044-22609122 31 2.6 02_02_0307 - 8809724-8811589,8811681-8811762,8812130-8812242,881... 31 2.6 07_03_1771 - 29404972-29405175,29405282-29405677 29 2.6 10_08_0630 - 19410852-19411235,19411370-19412257,19412440-194129... 28 3.0 04_01_0034 - 401208-402923 25 3.1 02_05_1120 + 34257504-34258294,34258483-34258571,34258616-342587... 25 3.2 05_01_0380 + 2978256-2979284 29 3.3 12_02_1174 - 26696869-26698191 30 3.4 11_01_0498 - 3828516-3829058 30 3.4 10_08_0221 - 15980370-15980927 30 3.4 10_08_0217 - 15962192-15962884 30 3.4 10_08_0213 - 15912048-15912716 30 3.4 09_06_0107 + 20907560-20908491,20908511-20908625,20908967-209090... 30 3.4 03_05_0501 - 24944533-24945507 30 3.4 02_05_1057 + 33809982-33810366,33810436-33810687,33810727-338109... 30 3.4 12_01_0399 + 3152219-3152721,3152995-3153127,3155013-3155097,315... 26 4.2 12_02_1122 - 26244667-26245299 25 4.4 12_02_1036 - 25587313-25587890,25589209-25589272,25589356-255894... 30 4.5 12_02_0628 + 21357876-21359921 30 4.5 09_04_0130 - 14905044-14905505,14905865-14905933,14906000-149061... 30 4.5 08_02_1258 - 25670092-25670152,25671124-25671327,25671400-256716... 30 4.5 08_01_0003 + 30085-30195,30289-30365,31080-31136,31668-33560,336... 30 4.5 06_03_0447 + 20878444-20878821 30 4.5 05_03_0665 - 16774043-16774522 30 4.5 05_01_0004 - 34967-35149,35340-35501,36078-36225,36309-36385,365... 30 4.5 01_01_1130 + 8959909-8960396,8960588-8960638,8960736-8960827,896... 30 4.5 07_01_0789 - 6150257-6151046,6151167-6151390,6151816-6151991,615... 24 5.1 12_02_1119 + 26213719-26213955,26214039-26214197,26214640-262147... 29 6.0 12_02_1070 - 25814741-25815850 29 6.0 12_02_0859 - 23751198-23753258 29 6.0 12_02_0408 + 18659494-18660362,18660472-18660634,18660976-186611... 29 6.0 12_01_0526 - 4171313-4171417,4171514-4171597,4171688-4171758,417... 29 6.0 12_01_0495 - 3935395-3937110 29 6.0 12_01_0442 + 3495333-3496484 29 6.0 12_01_0373 + 2897874-2898911 29 6.0 12_01_0319 + 2440129-2440661,2440875-2440902 29 6.0 11_06_0208 - 21268722-21268763,21269146-21269274,21269388-212695... 29 6.0 11_06_0081 + 19886848-19888050,19888243-19888896 29 6.0 11_01_0252 + 1934505-1935032,1936001-1936957 29 6.0 10_08_0527 - 18555231-18555882,18556334-18556463,18557073-18557175 29 6.0 10_06_0180 + 11526139-11526172,11526365-11527218 29 6.0 10_06_0152 - 11280532-11281427,11281501-11281971,11282512-11282569 29 6.0 10_03_0035 - 7265037-7265455,7265684-7265812,7265909-7265951,726... 29 6.0 10_03_0023 - 7151465-7152111,7152222-7152405 29 6.0 10_02_0134 + 5667236-5669295,5669833-5669902,5670266-5670376 29 6.0 10_02_0009 + 4128909-4130123 29 6.0 09_06_0149 - 21222976-21223065,21223460-21224173 29 6.0 09_04_0745 + 19884868-19886000,19886110-19886309,19886422-198866... 29 6.0 09_04_0112 - 14757947-14758972 29 6.0 09_04_0081 - 14400293-14400397,14400953-14401036,14401144-144012... 29 6.0 09_03_0130 - 12609417-12610462,12610786-12611040,12611139-126112... 29 6.0 09_02_0351 - 7686974-7686983,7687142-7687195,7687363-7687408,768... 29 6.0 09_01_0037 - 604001-604957 29 6.0 09_01_0016 - 376742-376883,377973-378964 29 6.0 08_02_1256 + 25645085-25645396 29 6.0 08_02_1081 + 24215323-24215335,24215450-24215572,24216241-242164... 29 6.0 08_02_0796 - 21300251-21300373,21300846-21301721 29 6.0 08_01_1081 + 11058119-11059756 29 6.0 08_01_0493 - 4297761-4298288 29 6.0 08_01_0420 + 3726392-3727116,3727450-3727648,3727787-3727879,372... 29 6.0 08_01_0204 + 1642169-1642687 29 6.0 08_01_0193 + 1599970-1600503,1601488-1601919,1602010-1602147,160... 29 6.0 08_01_0060 - 413088-413999 29 6.0 07_03_1381 - 26166673-26166747,26166972-26167544 29 6.0 07_03_1147 + 24349811-24350161,24351031-24351366,24353260-243533... 29 6.0 07_03_0890 - 22332768-22333382 29 6.0 07_03_0154 + 14509979-14512033 29 6.0 07_03_0111 + 13535912-13535972,13536081-13536142,13536418-135365... 29 6.0 07_01_0862 - 7172083-7172931 29 6.0 07_01_0753 - 5799733-5799741,5799938-5800642 29 6.0 07_01_0321 - 2255342-2255604,2256506-2256779,2256886-2257068 29 6.0 07_01_0080 + 587674-588510 29 6.0 06_03_1191 + 28286685-28287008,28287149-28287211,28287377-282874... 29 6.0 06_03_0750 - 24140988-24141037,24141108-24141345,24142158-241422... 29 6.0 06_03_0743 + 24069752-24070483,24071890-24072345 29 6.0 06_03_0696 + 23617687-23617851,23618838-23619536 29 6.0 06_03_0526 + 21771519-21771607,21771685-21771810,21771890-217720... 29 6.0 06_02_0257 - 13533689-13533714,13533799-13533925,13534013-135341... 29 6.0 06_02_0024 - 10714741-10716241,10716774-10717840 29 6.0 06_01_0921 + 7104923-7105396,7106624-7106768,7107078-7107121 29 6.0 06_01_0561 - 3983308-3983564,3983652-3983775 29 6.0 05_07_0332 - 29332520-29332818,29333511-29333725,29334380-293344... 29 6.0 05_06_0051 - 25190803-25191216,25191301-25191891,25193248-251933... 29 6.0 05_05_0207 + 23272777-23272977,23273831-23275330 29 6.0 05_05_0181 + 23033059-23033775 29 6.0 05_04_0173 + 18724367-18724476,18724570-18724651,18724750-187248... 29 6.0 05_04_0160 - 18624952-18625106,18625411-18625535,18625954-186260... 29 6.0 05_01_0210 + 1583176-1584177 29 6.0 05_01_0192 + 1394342-1396645 29 6.0 04_04_1687 - 35365766-35366356,35367137-35368135 29 6.0 04_04_0887 + 29095087-29096166 29 6.0 04_04_0708 - 27441373-27442611 29 6.0 04_04_0198 + 23502657-23502900,23505228-23505298,23505690-235057... 29 6.0 04_04_0057 + 22410167-22411330 29 6.0 04_03_0977 + 21381857-21383757,21384299-21384458,21384669-213847... 29 6.0 04_03_0212 + 12697854-12698549,12698655-12698930,12698991-126990... 29 6.0 04_01_0354 - 4646826-4647314 29 6.0 04_01_0246 + 3225743-3226473,3226493-3226624,3227580-3227670,322... 29 6.0 03_06_0771 - 36152554-36153215,36153320-36153818,36153924-36153956 29 6.0 03_06_0600 + 34988743-34989407,34990033-34990051 29 6.0 03_06_0599 + 34984869-34985319,34986581-34987563 29 6.0 03_06_0411 + 33741903-33742163,33742990-33743168,33743342-337434... 29 6.0 03_05_1096 - 30364144-30365310,30365825-30365971,30366087-303663... 29 6.0 03_05_0918 - 28785233-28786613,28786894-28787140,28787773-28788238 29 6.0 03_05_0732 - 27232299-27232535,27232717-27232746,27233094-272331... 29 6.0 03_02_0784 - 11154395-11154888,11155284-11155360,11155447-111554... 29 6.0 03_02_0455 - 8630543-8630893,8630994-8631068,8631149-8631223,863... 29 6.0 03_01_0219 + 1731267-1731728,1732148-1732235,1732330-1732417,173... 29 6.0 02_05_0925 - 32768815-32769654 29 6.0 02_05_0543 + 29872168-29872767,29873089-29873115 29 6.0 02_04_0520 - 23628183-23628195,23629354-23630036 29 6.0 02_04_0312 - 21942310-21943356 29 6.0 02_02_0489 + 10869482-10871218 29 6.0 02_02_0359 - 9390175-9390416,9390924-9391044,9391069-9391410,939... 29 6.0 02_01_0458 + 3291563-3291733,3292082-3292769,3292847-3293363,329... 29 6.0 02_01_0377 + 2728892-2729187,2729483-2729544,2730516-2730570,273... 29 6.0 02_01_0016 + 110796-110979,111252-111768,111847-112213 29 6.0 01_06_1805 - 39999987-40000169,40000648-40000974,40001724-400020... 29 6.0 01_06_1612 - 38635703-38636215,38638725-38638967 29 6.0 01_06_0883 + 32708037-32708558,32708627-32708911,32709661-32709675 29 6.0 01_06_0357 - 28668894-28669238,28669510-28669537,28669578-286696... 29 6.0 01_06_0090 + 26358051-26359157,26359582-26359701,26359968-263600... 29 6.0 01_05_0501 + 22764978-22765896,22766087-22766349,22766613-227668... 29 6.0 01_05_0423 + 22032940-22033695 29 6.0 01_03_0076 - 12241408-12241545,12241719-12241790,12242173-122422... 29 6.0 01_01_1162 - 9253034-9254229,9254387-9254456,9254473-9254567,925... 29 6.0 01_01_1001 - 7925858-7926559 29 6.0 01_01_0889 + 7008077-7009261 29 6.0 01_01_0761 - 5874953-5876803 29 6.0 01_01_0369 - 2886060-2886272,2886721-2887434 29 6.0 01_01_0046 - 331758-332627 29 6.0 05_01_0131 + 888247-888771,889092-889154 24 7.5 12_01_0477 + 3742751-3745200,3747192-3747502,3747886-3748232 29 7.9 10_08_0222 - 15983756-15984313 29 7.9 09_01_0112 + 1737438-1737777,1738441-1738511,1738974-1739052,174... 29 7.9 07_03_1524 + 27442435-27442627,27442928-27443323,27443815-27444116 29 7.9 07_03_0560 + 19479597-19480667 29 7.9 04_04_1149 + 31273203-31273695,31274016-31275165,31275617-31277078 29 7.9 03_05_0269 - 22545925-22546554,22546663-22547010,22547447-22547797 29 7.9 03_03_0038 + 13984525-13984917,13985351-13985429,13985535-139856... 29 7.9 01_06_0823 + 32234588-32234936,32236354-32237093,32237260-322373... 29 7.9 01_03_0005 + 11568545-11569119,11569179-11569191 29 7.9 01_01_0446 + 3321832-3322232,3322398-3322455,3322810-3323748,332... 29 7.9 03_06_0399 - 33632811-33633107,33633236-33633385,33633705-336340... 26 8.2 01_05_0552 - 23173106-23173184,23173266-23173411,23173543-231740... 26 8.3 06_03_1178 + 28203466-28204590,28204745-28205652,28206189-28206258 27 8.6 10_08_0925 + 21604871-21605021,21605562-21605881,21606899-216078... 26 8.8 03_06_0264 + 32738224-32738553,32739298-32739768,32739864-327400... 26 8.9 11_05_0093 + 18992027-18993514 27 8.9 01_06_1737 - 39559321-39559461,39559761-39559817,39559919-395601... 26 8.9 02_01_0158 - 1103461-1104186 26 9.5 02_01_0400 - 2922837-2923060,2923280-2923367,2923422-2923473,292... 26 9.7 02_01_0471 - 3364215-3364912,3365511-3365742,3365827-3366198,336... 26 9.8 10_08_0241 - 16111792-16112367 26 9.8 10_08_0240 - 16106963-16107538 26 9.8 >10_01_0100 + 1209424-1209538,1210373-1211073,1211158-1211379, 1211452-1211878,1212091-1213219,1213623-1213746, 1214207-1214278,1215480-1215578,1215617-1215640, 1215704-1215745,1215815-1215895,1215983-1216114, 1216115-1216196,1216271-1216365,1218499-1218570, 1218676-1218792,1219379-1219447,1219521-1219587, 1219886-1220025 Length = 1269 Score = 38.3 bits (85), Expect = 0.013 Identities = 17/48 (35%), Positives = 17/48 (35%) Frame = -3 Query: 1283 PPPPPPPPXXXXXXXXXXXXXXGGXGXXXPPXXXXXXXXXXPPPPPPP 1140 PPPPPPPP PP PPPPPPP Sbjct: 563 PPPPPPPPPPPPLPQSNYASSQPPPPPPPPPLPNCLVPSPPPPPPPPP 610 Score = 37.1 bits (82), Expect = 0.030 Identities = 17/49 (34%), Positives = 17/49 (34%) Frame = -2 Query: 1284 PPPPPPPPPXXXXXXXXXXXXGGGGGXXXPXXXXXXXXXXXXPPPPPPP 1138 PPPPPPPPP P PPPPPPP Sbjct: 544 PPPPPPPPPPPSGNKPAFSPPPPPPPPPPPPLPQSNYASSQPPPPPPPP 592 Score = 35.9 bits (79), Expect = 0.069 Identities = 19/49 (38%), Positives = 19/49 (38%) Frame = -2 Query: 1284 PPPPPPPPPXXXXXXXXXXXXGGGGGXXXPXXXXXXXXXXXXPPPPPPP 1138 PPPPPPPPP G G P PPPPPPP Sbjct: 634 PPPPPPPPPPSLPNRLVPPPPAPGIGNKFP----------APPPPPPPP 672 Score = 33.5 bits (73), Expect = 0.37 Identities = 17/48 (35%), Positives = 17/48 (35%) Frame = -3 Query: 1283 PPPPPPPPXXXXXXXXXXXXXXGGXGXXXPPXXXXXXXXXXPPPPPPP 1140 PPPPPPPP PP PPPPPPP Sbjct: 585 PPPPPPPPPLPNCLVPSPPPPP------PPPPILPNRSVPPPPPPPPP 626 Score = 33.5 bits (73), Expect = 0.37 Identities = 17/48 (35%), Positives = 17/48 (35%) Frame = -3 Query: 1283 PPPPPPPPXXXXXXXXXXXXXXGGXGXXXPPXXXXXXXXXXPPPPPPP 1140 PPPPPPPP PP PPPPPPP Sbjct: 602 PPPPPPPPPILPNRSVPPPPPP------PPPLPNHSVLPPPPPPPPPP 643 Score = 31.5 bits (68), Expect = 1.5 Identities = 16/48 (33%), Positives = 16/48 (33%) Frame = -3 Query: 1283 PPPPPPPPXXXXXXXXXXXXXXGGXGXXXPPXXXXXXXXXXPPPPPPP 1140 PPPPPPPP PP PP PPPP Sbjct: 712 PPPPPPPPPANRSNGP------SAPAPPLPPPLPAAANKRNPPAPPPP 753 Score = 30.3 bits (65), Expect = 3.4 Identities = 17/54 (31%), Positives = 17/54 (31%), Gaps = 5/54 (9%) Frame = -2 Query: 1284 PPPPPPPPP-----XXXXXXXXXXXXGGGGGXXXPXXXXXXXXXXXXPPPPPPP 1138 PPPPPPPPP P PPPPPPP Sbjct: 618 PPPPPPPPPLPNHSVLPPPPPPPPPPSLPNRLVPPPPAPGIGNKFPAPPPPPPP 671 Score = 29.9 bits (64), Expect = 4.5 Identities = 17/56 (30%), Positives = 17/56 (30%), Gaps = 8/56 (14%) Frame = -3 Query: 1283 PPPPPPPPXXXXXXXXXXXXXXGGXGXXXPP--------XXXXXXXXXXPPPPPPP 1140 P PPPPPP G PP PPPPPPP Sbjct: 663 PAPPPPPPPPRSSSRTPTGAATSSKGPPPPPPPPLPPANRTNGPGVPSAPPPPPPP 718 >01_01_0796 + 6190931-6192745 Length = 604 Score = 38.3 bits (85), Expect = 0.013 Identities = 17/48 (35%), Positives = 17/48 (35%) Frame = -3 Query: 1283 PPPPPPPPXXXXXXXXXXXXXXGGXGXXXPPXXXXXXXXXXPPPPPPP 1140 PPPPPPPP G P PPPPPPP Sbjct: 196 PPPPPPPPQPEQQLQLPQWPNLSGPHNQLLPVAPPPFVADQPPPPPPP 243 Score = 34.7 bits (76), Expect = 0.16 Identities = 16/49 (32%), Positives = 16/49 (32%) Frame = -2 Query: 1284 PPPPPPPPPXXXXXXXXXXXXGGGGGXXXPXXXXXXXXXXXXPPPPPPP 1138 PPPPPPPPP G PPPPPP Sbjct: 194 PPPPPPPPPPQPEQQLQLPQWPNLSGPHNQLLPVAPPPFVADQPPPPPP 242 Score = 31.9 bits (69), Expect = 1.1 Identities = 17/51 (33%), Positives = 17/51 (33%), Gaps = 2/51 (3%) Frame = -2 Query: 1284 PPPPP--PPPPXXXXXXXXXXXXGGGGGXXXPXXXXXXXXXXXXPPPPPPP 1138 PPPPP PPPP G PPPPPPP Sbjct: 193 PPPPPPPPPPPQPEQQLQLPQWPNLSGPHNQLLPVAPPPFVADQPPPPPPP 243 >04_03_0018 - 9434088-9434141,9434211-9434282,9434968-9435062, 9435445-9435526,9435610-9435660,9435749-9435829, 9435965-9436006,9436117-9436215,9438130-9438201, 9438557-9438680,9438850-9439723,9440274-9440456, 9440941-9442741,9442825-9443049,9443117-9443814, 9444519-9444591 Length = 1541 Score = 37.9 bits (84), Expect = 0.017 Identities = 17/45 (37%), Positives = 17/45 (37%) Frame = -2 Query: 1278 PPPPPPPXXXXXXXXXXXXGGGGGXXXPXXXXXXXXXXXXPPPPP 1144 PPPPPPP GG GG P PPPPP Sbjct: 1109 PPPPPPPGGITGVPPPPPIGGLGGHQAPPAPPLPEGIGGVPPPPP 1153 Score = 29.1 bits (62), Expect = 7.9 Identities = 14/45 (31%), Positives = 14/45 (31%) Frame = -3 Query: 1274 PPPPPXXXXXXXXXXXXXXGGXGXXXPPXXXXXXXXXXPPPPPPP 1140 PPPPP GG G P PPPPP Sbjct: 1109 PPPPPPPGGITGVPPPPPIGGLGGHQAPPAPPLPEGIGGVPPPPP 1153 >08_02_0937 + 22801526-22802461 Length = 311 Score = 36.3 bits (80), Expect = 0.052 Identities = 16/47 (34%), Positives = 16/47 (34%) Frame = -3 Query: 1280 PPPPPPPXXXXXXXXXXXXXXGGXGXXXPPXXXXXXXXXXPPPPPPP 1140 PPPPPPP PP PPPPPPP Sbjct: 33 PPPPPPPSRPLFCPRCRGEFLEEENPNPPPEPEEEEEVSSPPPPPPP 79 Score = 29.5 bits (63), Expect = 6.0 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1284 PPPPPPPPP 1258 PPPPPPPPP Sbjct: 73 PPPPPPPPP 81 >07_03_1136 + 24218601-24218734,24218769-24219906 Length = 423 Score = 35.9 bits (79), Expect = 0.069 Identities = 18/48 (37%), Positives = 18/48 (37%) Frame = +1 Query: 1141 GGGGGGGXXXXXXXXXXGGXXXPXPPXXXXXXXXXXXXXXGGGGGGGG 1284 GGGGGGG GG PP GGGGGG G Sbjct: 136 GGGGGGGAPRRVLGGGGGGGALARPPGGGRGGALGRPPGGGGGGGGPG 183 Score = 34.3 bits (75), Expect = 0.21 Identities = 17/46 (36%), Positives = 17/46 (36%) Frame = +1 Query: 1141 GGGGGGGXXXXXXXXXXGGXXXPXPPXXXXXXXXXXXXXXGGGGGG 1278 GGGGGGG GG P P GGGGGG Sbjct: 110 GGGGGGGPPSLPPGAGGGGGARPPAPGGGGGGGAPRRVLGGGGGGG 155 Score = 32.7 bits (71), Expect = 0.64 Identities = 17/48 (35%), Positives = 17/48 (35%) Frame = +3 Query: 1140 GGGGGGGXXXXXXXXXXGXXXXPXPPXPXXXXXXXXXXXXGGGGGGGG 1283 GGGGGGG G PP GGGGGG G Sbjct: 136 GGGGGGGAPRRVLGGGGGGGALARPPGGGRGGALGRPPGGGGGGGGPG 183 Score = 32.7 bits (71), Expect = 0.64 Identities = 18/47 (38%), Positives = 18/47 (38%) Frame = +1 Query: 1141 GGGGGGGXXXXXXXXXXGGXXXPXPPXXXXXXXXXXXXXXGGGGGGG 1281 GGGGGGG GG PP GGGGGGG Sbjct: 149 GGGGGGGALARPPGGGRGGALG-RPPGGGGGGGGPGRAPGGGGGGGG 194 Score = 31.1 bits (67), Expect = 2.0 Identities = 16/46 (34%), Positives = 16/46 (34%) Frame = +3 Query: 1140 GGGGGGGXXXXXXXXXXGXXXXPXPPXPXXXXXXXXXXXXGGGGGG 1277 GGGGGGG G P P GGGGGG Sbjct: 110 GGGGGGGPPSLPPGAGGGGGARPPAPGGGGGGGAPRRVLGGGGGGG 155 Score = 31.1 bits (67), Expect = 2.0 Identities = 17/48 (35%), Positives = 17/48 (35%) Frame = +1 Query: 1141 GGGGGGGXXXXXXXXXXGGXXXPXPPXXXXXXXXXXXXXXGGGGGGGG 1284 GGGGGGG GG GGGGGGGG Sbjct: 237 GGGGGGGGALKRAAGSGGGGGALECEIGGGGGGGGTDRNKGGGGGGGG 284 Score = 30.3 bits (65), Expect = 3.4 Identities = 19/49 (38%), Positives = 19/49 (38%) Frame = +2 Query: 1139 GGGGGGGXXXXXXXXXXXXGXXXPPPPPXXXXXXXXXXXXGGGGGGGGG 1285 GGGGGGG G PP GGGGGGGGG Sbjct: 320 GGGGGGGEIAGTVDLRGGGGGAGGVFPPTPDLG-------GGGGGGGGG 361 >05_04_0011 + 17139322-17139451,17139552-17140174 Length = 250 Score = 35.9 bits (79), Expect = 0.069 Identities = 18/49 (36%), Positives = 18/49 (36%) Frame = -2 Query: 1284 PPPPPPPPPXXXXXXXXXXXXGGGGGXXXPXXXXXXXXXXXXPPPPPPP 1138 PPPPPPPP G G P PPPPPPP Sbjct: 67 PPPPPPPPSPPNGGNVI-----GNGKRLTPTGPDPIHNEFQPPPPPPPP 110 Score = 29.5 bits (63), Expect = 6.0 Identities = 16/48 (33%), Positives = 16/48 (33%) Frame = -2 Query: 1284 PPPPPPPPPXXXXXXXXXXXXGGGGGXXXPXXXXXXXXXXXXPPPPPP 1141 PPPPPPPP G G P PPP PP Sbjct: 171 PPPPPPPPSPPNGANVI-----GDGKRLTPIGPDPIHNEFPPPPPSPP 213 Score = 29.1 bits (62), Expect = 7.9 Identities = 16/48 (33%), Positives = 16/48 (33%) Frame = -2 Query: 1284 PPPPPPPPPXXXXXXXXXXXXGGGGGXXXPXXXXXXXXXXXXPPPPPP 1141 PPPPPPP P G G P PPP PP Sbjct: 104 PPPPPPPSPPNGGKVI------GDGKRLTPTGPDPVHNKFQPPPPSPP 145 Score = 29.1 bits (62), Expect = 7.9 Identities = 16/47 (34%), Positives = 16/47 (34%) Frame = -2 Query: 1278 PPPPPPPXXXXXXXXXXXXGGGGGXXXPXXXXXXXXXXXXPPPPPPP 1138 PPPP PP G G P PPPPPPP Sbjct: 139 PPPPSPPNGGNVI-------GDGKRLTPTGPDPIHNEFQPPPPPPPP 178 >02_05_0686 - 30900748-30902167,30903442-30904742 Length = 906 Score = 35.5 bits (78), Expect = 0.091 Identities = 16/49 (32%), Positives = 16/49 (32%) Frame = -2 Query: 1284 PPPPPPPPPXXXXXXXXXXXXGGGGGXXXPXXXXXXXXXXXXPPPPPPP 1138 P PPPPPPP P PPPPPPP Sbjct: 311 PAPPPPPPPKPAAAAPPPPPPPKAAPPPPPPKGPPPPPPAKGPPPPPPP 359 Score = 31.9 bits (69), Expect = 1.1 Identities = 16/47 (34%), Positives = 16/47 (34%) Frame = -3 Query: 1280 PPPPPPPXXXXXXXXXXXXXXGGXGXXXPPXXXXXXXXXXPPPPPPP 1140 PPPPPPP PP PPPPPPP Sbjct: 326 PPPPPPPKAAPPPPPPKGPPPPPPAKGPPPPPPPKGPS--PPPPPPP 370 Score = 31.9 bits (69), Expect = 1.1 Identities = 15/47 (31%), Positives = 15/47 (31%) Frame = -3 Query: 1283 PPPPPPPPXXXXXXXXXXXXXXGGXGXXXPPXXXXXXXXXXPPPPPP 1143 PPPPPP G PP PPPPPP Sbjct: 336 PPPPPPKGPPPPPPAKGPPPPPPPKGPSPPPPPPPGGKKGGPPPPPP 382 >01_01_0892 + 7037384-7037795,7038447-7038962,7039507-7039593, 7039698-7039768,7040148-7040224,7040380-7040527, 7040973-7041134,7041374-7041694 Length = 597 Score = 35.5 bits (78), Expect = 0.091 Identities = 16/49 (32%), Positives = 16/49 (32%) Frame = -2 Query: 1284 PPPPPPPPPXXXXXXXXXXXXGGGGGXXXPXXXXXXXXXXXXPPPPPPP 1138 PPPPPPPPP P P PPPPP Sbjct: 126 PPPPPPPPPPFKGDHYGGVYQNWQQNGPPPPPDHVLKKVPSHPSPPPPP 174 Score = 33.1 bits (72), Expect = 0.49 Identities = 17/50 (34%), Positives = 17/50 (34%), Gaps = 2/50 (4%) Frame = -3 Query: 1283 PPPPPPPPXXXXXXXXXXXXXXGGXGXXXPPXXXXXXXXXXP--PPPPPP 1140 PPPPPPPP G PP P PPPP P Sbjct: 127 PPPPPPPPPFKGDHYGGVYQNWQQNGPPPPPDHVLKKVPSHPSPPPPPAP 176 >05_07_0200 - 28368890-28369021,28369169-28369303,28369918-28369947, 28370019-28370093,28370222-28370333,28370440-28370621, 28370723-28370854,28372193-28373479 Length = 694 Score = 35.1 bits (77), Expect = 0.12 Identities = 18/49 (36%), Positives = 18/49 (36%) Frame = -2 Query: 1284 PPPPPPPPPXXXXXXXXXXXXGGGGGXXXPXXXXXXXXXXXXPPPPPPP 1138 PPPPPPPPP G P PPPPPPP Sbjct: 310 PPPPPPPPPMPRSRSASPSPSTSSSGSAGP----------PAPPPPPPP 348 Score = 29.5 bits (63), Expect = 6.0 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1284 PPPPPPPPP 1258 PPPPPPPPP Sbjct: 238 PPPPPPPPP 246 >05_02_0081 + 6432957-6433289,6433367-6433882,6434283-6434570 Length = 378 Score = 31.1 bits (67), Expect = 2.0 Identities = 12/25 (48%), Positives = 12/25 (48%) Frame = -2 Query: 1284 PPPPPPPPPXXXXXXXXXXXXGGGG 1210 PPPPPPPP GGGG Sbjct: 170 PPPPPPPPASKSDHPAPLYGEGGGG 194 Score = 30.7 bits (66), Expect(2) = 0.14 Identities = 12/25 (48%), Positives = 12/25 (48%) Frame = -2 Query: 1281 PPPPPPPPXXXXXXXXXXXXGGGGG 1207 PPPPPPPP GGGG Sbjct: 170 PPPPPPPPASKSDHPAPLYGEGGGG 194 Score = 30.3 bits (65), Expect = 3.4 Identities = 12/26 (46%), Positives = 12/26 (46%) Frame = -2 Query: 1284 PPPPPPPPPXXXXXXXXXXXXGGGGG 1207 P PPPPPPP G GGG Sbjct: 168 PSPPPPPPPPASKSDHPAPLYGEGGG 193 Score = 23.0 bits (47), Expect(2) = 0.14 Identities = 7/9 (77%), Positives = 7/9 (77%) Frame = -2 Query: 1284 PPPPPPPPP 1258 P P PPPPP Sbjct: 166 PEPSPPPPP 174 >02_04_0180 + 20696258-20698398,20698691-20698871,20698998-20699060 Length = 794 Score = 34.7 bits (76), Expect = 0.16 Identities = 20/48 (41%), Positives = 20/48 (41%) Frame = -2 Query: 1281 PPPPPPPPXXXXXXXXXXXXGGGGGXXXPXXXXXXXXXXXXPPPPPPP 1138 PPPPPPPP GGGG P PPPPPPP Sbjct: 11 PPPPPPPPFGR----------GGGGAGYPRGHKQLYA----PPPPPPP 44 Score = 31.9 bits (69), Expect = 1.1 Identities = 19/48 (39%), Positives = 19/48 (39%) Frame = -3 Query: 1283 PPPPPPPPXXXXXXXXXXXXXXGGXGXXXPPXXXXXXXXXXPPPPPPP 1140 PPPPPPPP GG G P PPPPPPP Sbjct: 11 PPPPPPPP-----------FGRGGGGAGYP---RGHKQLYAPPPPPPP 44 >04_03_0243 - 13271384-13272865,13272987-13273248,13274617-13276067 Length = 1064 Score = 29.5 bits (63), Expect(2) = 0.17 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1284 PPPPPPPPP 1258 PPPPPPPPP Sbjct: 160 PPPPPPPPP 168 Score = 29.5 bits (63), Expect = 6.0 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1284 PPPPPPPPP 1258 PPPPPPPPP Sbjct: 161 PPPPPPPPP 169 Score = 29.5 bits (63), Expect = 6.0 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1284 PPPPPPPPP 1258 PPPPPPPPP Sbjct: 162 PPPPPPPPP 170 Score = 23.8 bits (49), Expect(2) = 0.17 Identities = 7/7 (100%), Positives = 7/7 (100%) Frame = -2 Query: 1158 PPPPPPP 1138 PPPPPPP Sbjct: 163 PPPPPPP 169 >01_06_1670 - 39007402-39008229,39008320-39008567,39009159-39009364, 39009454-39011054 Length = 960 Score = 29.5 bits (63), Expect(2) = 0.17 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1284 PPPPPPPPP 1258 PPPPPPPPP Sbjct: 422 PPPPPPPPP 430 Score = 29.5 bits (63), Expect = 6.0 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1284 PPPPPPPPP 1258 PPPPPPPPP Sbjct: 423 PPPPPPPPP 431 Score = 29.5 bits (63), Expect = 6.0 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1284 PPPPPPPPP 1258 PPPPPPPPP Sbjct: 424 PPPPPPPPP 432 Score = 29.5 bits (63), Expect = 6.0 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1284 PPPPPPPPP 1258 PPPPPPPPP Sbjct: 425 PPPPPPPPP 433 Score = 23.8 bits (49), Expect(2) = 0.17 Identities = 7/7 (100%), Positives = 7/7 (100%) Frame = -2 Query: 1158 PPPPPPP 1138 PPPPPPP Sbjct: 426 PPPPPPP 432 >10_06_0008 - 9533424-9533475,9533526-9535344,9535599-9536364, 9551969-9552097 Length = 921 Score = 30.3 bits (65), Expect = 3.4 Identities = 14/48 (29%), Positives = 14/48 (29%) Frame = -2 Query: 1284 PPPPPPPPPXXXXXXXXXXXXGGGGGXXXPXXXXXXXXXXXXPPPPPP 1141 PPPPPPPPP PPPPP Sbjct: 340 PPPPPPPPPPPDTNAILTQILAQQANMMNAFLHHLQNPPQHNAPPPPP 387 Score = 29.5 bits (63), Expect = 6.0 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1284 PPPPPPPPP 1258 PPPPPPPPP Sbjct: 338 PPPPPPPPP 346 Score = 29.5 bits (63), Expect(2) = 0.17 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1284 PPPPPPPPP 1258 PPPPPPPPP Sbjct: 339 PPPPPPPPP 347 Score = 23.8 bits (49), Expect(2) = 0.17 Identities = 7/7 (100%), Positives = 7/7 (100%) Frame = -2 Query: 1158 PPPPPPP 1138 PPPPPPP Sbjct: 344 PPPPPPP 350 >03_02_0071 + 5425722-5427154,5427259-5427464,5428445-5428686, 5428788-5429570 Length = 887 Score = 29.5 bits (63), Expect(2) = 0.17 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1284 PPPPPPPPP 1258 PPPPPPPPP Sbjct: 349 PPPPPPPPP 357 Score = 29.5 bits (63), Expect(2) = 0.17 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1284 PPPPPPPPP 1258 PPPPPPPPP Sbjct: 350 PPPPPPPPP 358 Score = 29.5 bits (63), Expect = 6.0 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1284 PPPPPPPPP 1258 PPPPPPPPP Sbjct: 351 PPPPPPPPP 359 Score = 29.5 bits (63), Expect = 6.0 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1284 PPPPPPPPP 1258 PPPPPPPPP Sbjct: 352 PPPPPPPPP 360 Score = 29.5 bits (63), Expect = 6.0 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1284 PPPPPPPPP 1258 PPPPPPPPP Sbjct: 353 PPPPPPPPP 361 Score = 29.5 bits (63), Expect = 6.0 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1284 PPPPPPPPP 1258 PPPPPPPPP Sbjct: 354 PPPPPPPPP 362 Score = 29.5 bits (63), Expect = 6.0 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1284 PPPPPPPPP 1258 PPPPPPPPP Sbjct: 355 PPPPPPPPP 363 Score = 29.5 bits (63), Expect = 6.0 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1284 PPPPPPPPP 1258 PPPPPPPPP Sbjct: 356 PPPPPPPPP 364 Score = 29.5 bits (63), Expect = 6.0 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1284 PPPPPPPPP 1258 PPPPPPPPP Sbjct: 357 PPPPPPPPP 365 Score = 29.5 bits (63), Expect = 6.0 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1284 PPPPPPPPP 1258 PPPPPPPPP Sbjct: 373 PPPPPPPPP 381 Score = 23.8 bits (49), Expect(2) = 0.17 Identities = 7/7 (100%), Positives = 7/7 (100%) Frame = -2 Query: 1158 PPPPPPP 1138 PPPPPPP Sbjct: 354 PPPPPPP 360 Score = 23.8 bits (49), Expect(2) = 0.17 Identities = 7/7 (100%), Positives = 7/7 (100%) Frame = -2 Query: 1158 PPPPPPP 1138 PPPPPPP Sbjct: 359 PPPPPPP 365 >02_03_0279 + 17250347-17252098 Length = 583 Score = 29.5 bits (63), Expect = 6.0 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1284 PPPPPPPPP 1258 PPPPPPPPP Sbjct: 124 PPPPPPPPP 132 Score = 29.5 bits (63), Expect(2) = 0.18 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1284 PPPPPPPPP 1258 PPPPPPPPP Sbjct: 125 PPPPPPPPP 133 Score = 29.5 bits (63), Expect = 6.0 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1284 PPPPPPPPP 1258 PPPPPPPPP Sbjct: 126 PPPPPPPPP 134 Score = 29.5 bits (63), Expect = 6.0 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1284 PPPPPPPPP 1258 PPPPPPPPP Sbjct: 127 PPPPPPPPP 135 Score = 29.5 bits (63), Expect = 6.0 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1284 PPPPPPPPP 1258 PPPPPPPPP Sbjct: 128 PPPPPPPPP 136 Score = 23.8 bits (49), Expect(2) = 0.18 Identities = 7/7 (100%), Positives = 7/7 (100%) Frame = -2 Query: 1158 PPPPPPP 1138 PPPPPPP Sbjct: 130 PPPPPPP 136 >11_06_0016 - 19284810-19284926,19285527-19286879 Length = 489 Score = 29.5 bits (63), Expect(2) = 0.18 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1284 PPPPPPPPP 1258 PPPPPPPPP Sbjct: 87 PPPPPPPPP 95 Score = 29.5 bits (63), Expect(2) = 0.18 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1284 PPPPPPPPP 1258 PPPPPPPPP Sbjct: 88 PPPPPPPPP 96 Score = 29.5 bits (63), Expect = 6.0 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1284 PPPPPPPPP 1258 PPPPPPPPP Sbjct: 89 PPPPPPPPP 97 Score = 26.2 bits (55), Expect(2) = 1.4 Identities = 8/9 (88%), Positives = 8/9 (88%) Frame = -2 Query: 1284 PPPPPPPPP 1258 PP PPPPPP Sbjct: 84 PPSPPPPPP 92 Score = 23.8 bits (49), Expect(2) = 1.4 Identities = 7/7 (100%), Positives = 7/7 (100%) Frame = -2 Query: 1158 PPPPPPP 1138 PPPPPPP Sbjct: 87 PPPPPPP 93 Score = 23.8 bits (49), Expect(2) = 0.18 Identities = 7/7 (100%), Positives = 7/7 (100%) Frame = -2 Query: 1158 PPPPPPP 1138 PPPPPPP Sbjct: 90 PPPPPPP 96 Score = 23.8 bits (49), Expect(2) = 0.18 Identities = 7/7 (100%), Positives = 7/7 (100%) Frame = -2 Query: 1158 PPPPPPP 1138 PPPPPPP Sbjct: 91 PPPPPPP 97 >04_04_1027 - 30216859-30217212,30218769-30219178,30219395-30219800 Length = 389 Score = 29.5 bits (63), Expect(2) = 0.18 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1284 PPPPPPPPP 1258 PPPPPPPPP Sbjct: 26 PPPPPPPPP 34 Score = 29.5 bits (63), Expect = 6.0 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1284 PPPPPPPPP 1258 PPPPPPPPP Sbjct: 27 PPPPPPPPP 35 Score = 29.5 bits (63), Expect = 6.0 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1284 PPPPPPPPP 1258 PPPPPPPPP Sbjct: 28 PPPPPPPPP 36 Score = 29.5 bits (63), Expect = 6.0 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1284 PPPPPPPPP 1258 PPPPPPPPP Sbjct: 29 PPPPPPPPP 37 Score = 25.8 bits (54), Expect(2) = 1.9 Identities = 8/9 (88%), Positives = 8/9 (88%) Frame = -2 Query: 1284 PPPPPPPPP 1258 P PPPPPPP Sbjct: 24 PVPPPPPPP 32 Score = 23.8 bits (49), Expect(2) = 1.9 Identities = 7/7 (100%), Positives = 7/7 (100%) Frame = -2 Query: 1158 PPPPPPP 1138 PPPPPPP Sbjct: 28 PPPPPPP 34 Score = 23.8 bits (49), Expect(2) = 0.18 Identities = 7/7 (100%), Positives = 7/7 (100%) Frame = -2 Query: 1158 PPPPPPP 1138 PPPPPPP Sbjct: 29 PPPPPPP 35 >02_04_0567 - 23914330-23914461,23915016-23915136,23915954-23916048, 23916131-23916301,23917291-23917380,23917636-23918139 Length = 370 Score = 29.5 bits (63), Expect = 6.0 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1284 PPPPPPPPP 1258 PPPPPPPPP Sbjct: 38 PPPPPPPPP 46 Score = 29.5 bits (63), Expect(2) = 0.18 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1284 PPPPPPPPP 1258 PPPPPPPPP Sbjct: 39 PPPPPPPPP 47 Score = 29.5 bits (63), Expect(2) = 0.18 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1284 PPPPPPPPP 1258 PPPPPPPPP Sbjct: 40 PPPPPPPPP 48 Score = 29.5 bits (63), Expect = 6.0 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1284 PPPPPPPPP 1258 PPPPPPPPP Sbjct: 41 PPPPPPPPP 49 Score = 29.5 bits (63), Expect = 6.0 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1284 PPPPPPPPP 1258 PPPPPPPPP Sbjct: 42 PPPPPPPPP 50 Score = 29.5 bits (63), Expect = 6.0 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1284 PPPPPPPPP 1258 PPPPPPPPP Sbjct: 43 PPPPPPPPP 51 Score = 29.5 bits (63), Expect = 6.0 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1284 PPPPPPPPP 1258 PPPPPPPPP Sbjct: 44 PPPPPPPPP 52 Score = 29.5 bits (63), Expect = 6.0 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1284 PPPPPPPPP 1258 PPPPPPPPP Sbjct: 45 PPPPPPPPP 53 Score = 29.5 bits (63), Expect = 6.0 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1284 PPPPPPPPP 1258 PPPPPPPPP Sbjct: 46 PPPPPPPPP 54 Score = 29.5 bits (63), Expect = 6.0 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1284 PPPPPPPPP 1258 PPPPPPPPP Sbjct: 47 PPPPPPPPP 55 Score = 29.5 bits (63), Expect = 6.0 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1284 PPPPPPPPP 1258 PPPPPPPPP Sbjct: 48 PPPPPPPPP 56 Score = 23.8 bits (49), Expect(2) = 0.18 Identities = 7/7 (100%), Positives = 7/7 (100%) Frame = -2 Query: 1158 PPPPPPP 1138 PPPPPPP Sbjct: 43 PPPPPPP 49 Score = 23.8 bits (49), Expect(2) = 0.18 Identities = 7/7 (100%), Positives = 7/7 (100%) Frame = -2 Query: 1158 PPPPPPP 1138 PPPPPPP Sbjct: 44 PPPPPPP 50 >04_01_0197 + 2323790-2324098,2324145-2324774 Length = 312 Score = 30.3 bits (65), Expect = 3.4 Identities = 14/48 (29%), Positives = 14/48 (29%) Frame = -2 Query: 1284 PPPPPPPPPXXXXXXXXXXXXGGGGGXXXPXXXXXXXXXXXXPPPPPP 1141 PPPPPPPPP PPPPP Sbjct: 31 PPPPPPPPPPPDTNAILTQILAQQANMMTAFLHHLQNPPQHNAPPPPP 78 Score = 29.5 bits (63), Expect = 6.0 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1284 PPPPPPPPP 1258 PPPPPPPPP Sbjct: 27 PPPPPPPPP 35 Score = 29.5 bits (63), Expect(2) = 0.18 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1284 PPPPPPPPP 1258 PPPPPPPPP Sbjct: 28 PPPPPPPPP 36 Score = 29.5 bits (63), Expect(2) = 0.18 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1284 PPPPPPPPP 1258 PPPPPPPPP Sbjct: 29 PPPPPPPPP 37 Score = 29.5 bits (63), Expect = 6.0 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1284 PPPPPPPPP 1258 PPPPPPPPP Sbjct: 30 PPPPPPPPP 38 Score = 23.8 bits (49), Expect(2) = 0.18 Identities = 7/7 (100%), Positives = 7/7 (100%) Frame = -2 Query: 1158 PPPPPPP 1138 PPPPPPP Sbjct: 33 PPPPPPP 39 Score = 23.8 bits (49), Expect(2) = 0.18 Identities = 7/7 (100%), Positives = 7/7 (100%) Frame = -2 Query: 1158 PPPPPPP 1138 PPPPPPP Sbjct: 35 PPPPPPP 41 >07_01_0015 + 108338-109186 Length = 282 Score = 29.5 bits (63), Expect(2) = 0.18 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1284 PPPPPPPPP 1258 PPPPPPPPP Sbjct: 105 PPPPPPPPP 113 Score = 29.5 bits (63), Expect = 6.0 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1284 PPPPPPPPP 1258 PPPPPPPPP Sbjct: 106 PPPPPPPPP 114 Score = 23.8 bits (49), Expect(2) = 0.18 Identities = 7/7 (100%), Positives = 7/7 (100%) Frame = -2 Query: 1158 PPPPPPP 1138 PPPPPPP Sbjct: 108 PPPPPPP 114 >04_03_1022 - 21778315-21779007 Length = 230 Score = 29.5 bits (63), Expect(2) = 0.19 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1284 PPPPPPPPP 1258 PPPPPPPPP Sbjct: 36 PPPPPPPPP 44 Score = 29.5 bits (63), Expect = 6.0 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1284 PPPPPPPPP 1258 PPPPPPPPP Sbjct: 37 PPPPPPPPP 45 Score = 29.5 bits (63), Expect = 6.0 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1284 PPPPPPPPP 1258 PPPPPPPPP Sbjct: 38 PPPPPPPPP 46 Score = 23.8 bits (49), Expect(2) = 0.19 Identities = 7/7 (100%), Positives = 7/7 (100%) Frame = -2 Query: 1158 PPPPPPP 1138 PPPPPPP Sbjct: 40 PPPPPPP 46 >01_06_1321 + 36280691-36281269 Length = 192 Score = 29.5 bits (63), Expect(2) = 0.19 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1284 PPPPPPPPP 1258 PPPPPPPPP Sbjct: 147 PPPPPPPPP 155 Score = 29.5 bits (63), Expect = 6.0 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1284 PPPPPPPPP 1258 PPPPPPPPP Sbjct: 148 PPPPPPPPP 156 Score = 23.8 bits (49), Expect(2) = 0.19 Identities = 7/7 (100%), Positives = 7/7 (100%) Frame = -2 Query: 1158 PPPPPPP 1138 PPPPPPP Sbjct: 150 PPPPPPP 156 >06_03_0214 + 18067945-18068463,18068940-18069839,18069918-18070652 Length = 717 Score = 33.9 bits (74), Expect = 0.28 Identities = 16/49 (32%), Positives = 16/49 (32%) Frame = -2 Query: 1284 PPPPPPPPPXXXXXXXXXXXXGGGGGXXXPXXXXXXXXXXXXPPPPPPP 1138 PPPPPPPPP PPPPPPP Sbjct: 203 PPPPPPPPPPDTNSILTQILAQQANMMAAFLHHIQNPPQHNAPPPPPPP 251 Score = 31.9 bits (69), Expect = 1.1 Identities = 15/48 (31%), Positives = 15/48 (31%) Frame = -3 Query: 1283 PPPPPPPPXXXXXXXXXXXXXXGGXGXXXPPXXXXXXXXXXPPPPPPP 1140 PPPPPPPP PPPPPPP Sbjct: 204 PPPPPPPPPDTNSILTQILAQQANMMAAFLHHIQNPPQHNAPPPPPPP 251 >10_08_0216 - 15942379-15942852,15942956-15943033 Length = 183 Score = 33.5 bits (73), Expect = 0.37 Identities = 18/49 (36%), Positives = 18/49 (36%) Frame = +3 Query: 1140 GGGGGGGXXXXXXXXXXGXXXXPXPPXPXXXXXXXXXXXXGGGGGGGGG 1286 GGGGGGG G P GGGGGGGGG Sbjct: 38 GGGGGGGGGGGGYYGPYGPYYGPYYGPYYGPYASGGAAASGGGGGGGGG 86 Score = 33.1 bits (72), Expect = 0.49 Identities = 17/47 (36%), Positives = 17/47 (36%) Frame = +1 Query: 1141 GGGGGGGXXXXXXXXXXGGXXXPXPPXXXXXXXXXXXXXXGGGGGGG 1281 GGGGGGG GG P GGGGGGG Sbjct: 78 GGGGGGGGGGGYGYGAGGGYGQAGGPYYGPYASGGGGGGAGGGGGGG 124 Score = 30.7 bits (66), Expect = 2.6 Identities = 17/49 (34%), Positives = 17/49 (34%) Frame = +3 Query: 1140 GGGGGGGXXXXXXXXXXGXXXXPXPPXPXXXXXXXXXXXXGGGGGGGGG 1286 GGGGGGG G P GGGGGGG G Sbjct: 78 GGGGGGGGGGGYGYGAGGGYGQAGGPYYGPYASGGGGGGAGGGGGGGYG 126 Score = 29.5 bits (63), Expect = 6.0 Identities = 18/49 (36%), Positives = 18/49 (36%) Frame = +2 Query: 1139 GGGGGGGXXXXXXXXXXXXGXXXPPPPPXXXXXXXXXXXXGGGGGGGGG 1285 GGGGGGG G P GGGGGGGGG Sbjct: 40 GGGGGGGGGGYYGPYGPYYGPYYGPYY-GPYASGGAAASGGGGGGGGGG 87 >10_06_0039 - 9966744-9967535,9968241-9968482,9969021-9969223, 9969333-9970645 Length = 849 Score = 33.5 bits (73), Expect = 0.37 Identities = 15/48 (31%), Positives = 15/48 (31%) Frame = -2 Query: 1281 PPPPPPPPXXXXXXXXXXXXGGGGGXXXPXXXXXXXXXXXXPPPPPPP 1138 PPP PP P G G PPPPPPP Sbjct: 290 PPPAPPAPRSRRTPPRTRFSAGSGAEMNKQMASPPSNPPPAPPPPPPP 337 Score = 29.1 bits (62), Expect = 7.9 Identities = 14/48 (29%), Positives = 14/48 (29%) Frame = -3 Query: 1283 PPPPPPPPXXXXXXXXXXXXXXGGXGXXXPPXXXXXXXXXXPPPPPPP 1140 PPP PP P G PPPPPPP Sbjct: 290 PPPAPPAPRSRRTPPRTRFSAGSGAEMNKQMASPPSNPPPAPPPPPPP 337 Score = 26.6 bits (56), Expect(2) = 0.38 Identities = 8/8 (100%), Positives = 8/8 (100%) Frame = -3 Query: 1283 PPPPPPPP 1260 PPPPPPPP Sbjct: 331 PPPPPPPP 338 Score = 25.4 bits (53), Expect(2) = 0.38 Identities = 9/19 (47%), Positives = 9/19 (47%) Frame = -3 Query: 1196 PPXXXXXXXXXXPPPPPPP 1140 PP PPPPPPP Sbjct: 336 PPPSRFNNTTPKPPPPPPP 354 >06_03_0729 + 23927656-23927661,23927774-23927923,23928316-23928567, 23929072-23929209,23931213-23932730 Length = 687 Score = 33.5 bits (73), Expect = 0.37 Identities = 13/26 (50%), Positives = 13/26 (50%) Frame = -2 Query: 1284 PPPPPPPPPXXXXXXXXXXXXGGGGG 1207 PPP PPPPP GGGGG Sbjct: 211 PPPSPPPPPPSPAAHRRCSSSGGGGG 236 Score = 31.1 bits (67), Expect = 2.0 Identities = 12/26 (46%), Positives = 12/26 (46%) Frame = -2 Query: 1284 PPPPPPPPPXXXXXXXXXXXXGGGGG 1207 PPPP PPPP GGGG Sbjct: 210 PPPPSPPPPPPSPAAHRRCSSSGGGG 235 >04_03_0660 + 18463011-18463322,18463424-18463516,18464500-18464607, 18464892-18465044,18465256-18465354,18465443-18465571, 18465987-18466166,18466208-18466246,18466247-18466363, 18466445-18466609 Length = 464 Score = 33.5 bits (73), Expect = 0.37 Identities = 13/26 (50%), Positives = 13/26 (50%) Frame = -2 Query: 1284 PPPPPPPPPXXXXXXXXXXXXGGGGG 1207 PPPPPPPP GGGGG Sbjct: 52 PPPPPPPPTQPAPPPPPPARSGGGGG 77 >08_01_0375 - 3307206-3307316,3307870-3307965,3308061-3308132, 3308247-3308315,3308427-3308513,3308753-3308858, 3309118-3309237,3309327-3309406,3309497-3309878, 3310746-3310814,3311460-3312202 Length = 644 Score = 32.3 bits (70), Expect = 0.85 Identities = 17/49 (34%), Positives = 17/49 (34%) Frame = -2 Query: 1284 PPPPPPPPPXXXXXXXXXXXXGGGGGXXXPXXXXXXXXXXXXPPPPPPP 1138 PPPPPPP P G G PPPPPPP Sbjct: 54 PPPPPPPGPPPPHQPQFNF----GPGPPQQQQPPPPPQMYYQPPPPPPP 98 Score = 31.1 bits (67), Expect = 2.0 Identities = 14/46 (30%), Positives = 14/46 (30%) Frame = -3 Query: 1277 PPPPPPXXXXXXXXXXXXXXGGXGXXXPPXXXXXXXXXXPPPPPPP 1140 PPPPP PP PPPPPPP Sbjct: 82 PPPPPQMYYQPPPPPPPYGVNSSQPPPPPPPPPSPPPSAPPPPPPP 127 Score = 30.3 bits (65), Expect = 3.4 Identities = 14/47 (29%), Positives = 14/47 (29%) Frame = -3 Query: 1280 PPPPPPPXXXXXXXXXXXXXXGGXGXXXPPXXXXXXXXXXPPPPPPP 1140 PPPPP PP PPPPPPP Sbjct: 82 PPPPPQMYYQPPPPPPPYGVNSSQPPPPPPPPPSPPPSAPPPPPPPP 128 Score = 29.5 bits (63), Expect = 6.0 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1284 PPPPPPPPP 1258 PPPPPPPPP Sbjct: 106 PPPPPPPPP 114 >05_07_0031 - 27183252-27183317,27183542-27184282 Length = 268 Score = 32.3 bits (70), Expect = 0.85 Identities = 17/49 (34%), Positives = 17/49 (34%) Frame = -2 Query: 1284 PPPPPPPPPXXXXXXXXXXXXGGGGGXXXPXXXXXXXXXXXXPPPPPPP 1138 PPPPPPPPP P PPPPPPP Sbjct: 117 PPPPPPPPPPPPTTTTKP--------ESLPAEADSEPELKAPPPPPPPP 157 Score = 31.5 bits (68), Expect = 1.5 Identities = 17/48 (35%), Positives = 17/48 (35%) Frame = -3 Query: 1283 PPPPPPPPXXXXXXXXXXXXXXGGXGXXXPPXXXXXXXXXXPPPPPPP 1140 PPPPPPPP PP PPPPPPP Sbjct: 121 PPPPPPPPTTTTKPESLPAEADSEPELKAPP----------PPPPPPP 158 Score = 29.9 bits (64), Expect = 4.5 Identities = 16/49 (32%), Positives = 16/49 (32%) Frame = -2 Query: 1284 PPPPPPPPPXXXXXXXXXXXXGGGGGXXXPXXXXXXXXXXXXPPPPPPP 1138 PPPPPPPPP PPPPPPP Sbjct: 118 PPPPPPPPPPPTTTTKPESLPAEADSEPE--------LKAPPPPPPPPP 158 >07_01_0439 + 3333654-3334217 Length = 187 Score = 31.9 bits (69), Expect = 1.1 Identities = 13/30 (43%), Positives = 13/30 (43%) Frame = -2 Query: 1284 PPPPPPPPPXXXXXXXXXXXXGGGGGXXXP 1195 PPPPPPP GGGGG P Sbjct: 35 PPPPPPPASRPPKKPRVVASGGGGGGDAGP 64 >04_04_0137 - 23053148-23053798,23053911-23054146,23054268-23054458, 23054587-23056010 Length = 833 Score = 31.9 bits (69), Expect = 1.1 Identities = 17/48 (35%), Positives = 17/48 (35%) Frame = -2 Query: 1284 PPPPPPPPPXXXXXXXXXXXXGGGGGXXXPXXXXXXXXXXXXPPPPPP 1141 PPPPPPPPP G P PPPPPP Sbjct: 366 PPPPPPPPPPPPPAVTQQQDVKTSCGPAVP------PPPPPTPPPPPP 407 Score = 29.5 bits (63), Expect = 6.0 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1284 PPPPPPPPP 1258 PPPPPPPPP Sbjct: 365 PPPPPPPPP 373 >01_01_0715 - 5542648-5543219,5543352-5543544 Length = 254 Score = 31.9 bits (69), Expect = 1.1 Identities = 17/51 (33%), Positives = 17/51 (33%), Gaps = 3/51 (5%) Frame = -3 Query: 1283 PPPPPPPPXXXXXXXXXXXXXXGGXG---XXXPPXXXXXXXXXXPPPPPPP 1140 PPPPP P G G PP PPPPPPP Sbjct: 145 PPPPPTVPAAPTPRPSPPPPAAGTNGTARAPSPPVPAPAPAGSPPPPPPPP 195 Score = 31.1 bits (67), Expect = 2.0 Identities = 15/49 (30%), Positives = 15/49 (30%) Frame = -2 Query: 1284 PPPPPPPPPXXXXXXXXXXXXGGGGGXXXPXXXXXXXXXXXXPPPPPPP 1138 PPPP P G G P PPPPPPP Sbjct: 146 PPPPTVPAAPTPRPSPPPPAAGTNGTARAPSPPVPAPAPAGSPPPPPPP 194 >01_01_0623 + 4672581-4673413,4674274-4674389,4674694-4674902, 4675953-4676072,4676185-4676313,4676394-4676442, 4676899-4676970,4677574-4677707,4677798-4677915, 4678332-4678541,4678630-4678942,4679539-4679632, 4679854-4679962,4680243-4680514,4680597-4680724, 4680832-4681066,4681570-4681758,4681845-4682128, 4682218-4682398,4682486-4682728,4682904-4682986, 4683119-4683227,4687996-4688091,4688675-4688764, 4688881-4689129,4689233-4689412,4690179-4690250, 4691385-4691474,4691605-4691705,4691794-4691959 Length = 1757 Score = 26.2 bits (55), Expect(2) = 1.3 Identities = 8/9 (88%), Positives = 8/9 (88%) Frame = -2 Query: 1284 PPPPPPPPP 1258 PP PPPPPP Sbjct: 52 PPSPPPPPP 60 Score = 26.2 bits (55), Expect(2) = 1.3 Identities = 8/9 (88%), Positives = 8/9 (88%) Frame = -2 Query: 1284 PPPPPPPPP 1258 P PPPPPPP Sbjct: 53 PSPPPPPPP 61 Score = 23.8 bits (49), Expect(2) = 1.3 Identities = 7/7 (100%), Positives = 7/7 (100%) Frame = -2 Query: 1158 PPPPPPP 1138 PPPPPPP Sbjct: 55 PPPPPPP 61 Score = 23.8 bits (49), Expect(2) = 1.3 Identities = 7/7 (100%), Positives = 7/7 (100%) Frame = -2 Query: 1158 PPPPPPP 1138 PPPPPPP Sbjct: 56 PPPPPPP 62 >01_06_0969 - 33472588-33474480,33475543-33475623,33475692-33475740, 33475866-33476281,33477208-33477447 Length = 892 Score = 26.2 bits (55), Expect(2) = 1.4 Identities = 8/9 (88%), Positives = 8/9 (88%) Frame = -2 Query: 1284 PPPPPPPPP 1258 P PPPPPPP Sbjct: 272 PQPPPPPPP 280 Score = 23.8 bits (49), Expect(2) = 1.4 Identities = 7/7 (100%), Positives = 7/7 (100%) Frame = -2 Query: 1158 PPPPPPP 1138 PPPPPPP Sbjct: 275 PPPPPPP 281 >05_04_0206 + 19034259-19035462,19036870-19037045,19037752-19037975, 19038133-19038914,19039337-19039494 Length = 847 Score = 29.5 bits (63), Expect = 6.0 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1284 PPPPPPPPP 1258 PPPPPPPPP Sbjct: 218 PPPPPPPPP 226 Score = 29.5 bits (63), Expect = 6.0 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1284 PPPPPPPPP 1258 PPPPPPPPP Sbjct: 219 PPPPPPPPP 227 Score = 26.2 bits (55), Expect(2) = 1.4 Identities = 8/9 (88%), Positives = 8/9 (88%) Frame = -2 Query: 1284 PPPPPPPPP 1258 P PPPPPPP Sbjct: 216 PQPPPPPPP 224 Score = 23.8 bits (49), Expect(2) = 1.4 Identities = 7/7 (100%), Positives = 7/7 (100%) Frame = -2 Query: 1158 PPPPPPP 1138 PPPPPPP Sbjct: 219 PPPPPPP 225 >07_03_0435 + 18182657-18183509,18184477-18184574,18184663-18184833, 18185524-18185624,18185702-18185837,18186007-18186057, 18186202-18186489,18186610-18186844,18186924-18187204, 18187336-18187557 Length = 811 Score = 26.2 bits (55), Expect(2) = 1.4 Identities = 8/9 (88%), Positives = 8/9 (88%) Frame = -2 Query: 1284 PPPPPPPPP 1258 P PPPPPPP Sbjct: 77 PQPPPPPPP 85 Score = 23.8 bits (49), Expect(2) = 1.4 Identities = 7/7 (100%), Positives = 7/7 (100%) Frame = -2 Query: 1158 PPPPPPP 1138 PPPPPPP Sbjct: 80 PPPPPPP 86 >08_01_0207 - 1647168-1647251,1647583-1647726,1648176-1648287, 1648392-1648573,1648649-1648780,1648900-1649856, 1649949-1650734 Length = 798 Score = 26.2 bits (55), Expect(2) = 1.4 Identities = 8/9 (88%), Positives = 8/9 (88%) Frame = -2 Query: 1284 PPPPPPPPP 1258 PP PPPPPP Sbjct: 508 PPKPPPPPP 516 Score = 23.8 bits (49), Expect(2) = 1.4 Identities = 7/7 (100%), Positives = 7/7 (100%) Frame = -2 Query: 1158 PPPPPPP 1138 PPPPPPP Sbjct: 511 PPPPPPP 517 >09_03_0145 - 12749288-12751510 Length = 740 Score = 26.2 bits (55), Expect(2) = 1.4 Identities = 8/9 (88%), Positives = 8/9 (88%) Frame = -2 Query: 1284 PPPPPPPPP 1258 P PPPPPPP Sbjct: 28 PSPPPPPPP 36 Score = 23.8 bits (49), Expect(2) = 1.4 Identities = 7/7 (100%), Positives = 7/7 (100%) Frame = -2 Query: 1158 PPPPPPP 1138 PPPPPPP Sbjct: 31 PPPPPPP 37 >01_07_0021 - 40533864-40534583,40534779-40534814,40534909-40535048, 40535837-40535922,40536430-40536653,40536770-40536865, 40538766-40538833,40539945-40540055,40540799-40540955 Length = 545 Score = 26.2 bits (55), Expect(2) = 1.4 Identities = 8/9 (88%), Positives = 8/9 (88%) Frame = -2 Query: 1284 PPPPPPPPP 1258 P PPPPPPP Sbjct: 532 PAPPPPPPP 540 Score = 23.8 bits (49), Expect(2) = 1.4 Identities = 7/7 (100%), Positives = 7/7 (100%) Frame = -2 Query: 1158 PPPPPPP 1138 PPPPPPP Sbjct: 535 PPPPPPP 541 >10_08_0534 + 18595520-18595828,18595917-18597149 Length = 513 Score = 29.5 bits (63), Expect = 6.0 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1284 PPPPPPPPP 1258 PPPPPPPPP Sbjct: 35 PPPPPPPPP 43 Score = 29.5 bits (63), Expect = 6.0 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1284 PPPPPPPPP 1258 PPPPPPPPP Sbjct: 36 PPPPPPPPP 44 Score = 26.2 bits (55), Expect(2) = 1.4 Identities = 8/9 (88%), Positives = 8/9 (88%) Frame = -2 Query: 1284 PPPPPPPPP 1258 P PPPPPPP Sbjct: 33 PSPPPPPPP 41 Score = 23.8 bits (49), Expect(2) = 1.4 Identities = 7/7 (100%), Positives = 7/7 (100%) Frame = -2 Query: 1158 PPPPPPP 1138 PPPPPPP Sbjct: 36 PPPPPPP 42 >12_01_0252 + 1868670-1869200,1870167-1871120 Length = 494 Score = 31.5 bits (68), Expect = 1.5 Identities = 12/25 (48%), Positives = 12/25 (48%) Frame = -2 Query: 1281 PPPPPPPPXXXXXXXXXXXXGGGGG 1207 PPPPPPPP GGGG Sbjct: 63 PPPPPPPPLNWPTAGGGGGGSGGGG 87 Score = 30.3 bits (65), Expect = 3.4 Identities = 12/25 (48%), Positives = 12/25 (48%) Frame = -2 Query: 1284 PPPPPPPPPXXXXXXXXXXXXGGGG 1210 PPPPPPPP GGGG Sbjct: 63 PPPPPPPPLNWPTAGGGGGGSGGGG 87 Score = 30.3 bits (65), Expect = 3.4 Identities = 12/25 (48%), Positives = 12/25 (48%) Frame = +2 Query: 1208 PPPPPXXXXXXXXXXXXGGGGGGGG 1282 PPPPP GGG GGGG Sbjct: 63 PPPPPPPPLNWPTAGGGGGGSGGGG 87 Score = 29.9 bits (64), Expect = 4.5 Identities = 12/25 (48%), Positives = 12/25 (48%) Frame = +2 Query: 1211 PPPPXXXXXXXXXXXXGGGGGGGGG 1285 PPPP GGGG GGGG Sbjct: 63 PPPPPPPPLNWPTAGGGGGGSGGGG 87 Score = 29.5 bits (63), Expect = 6.0 Identities = 12/26 (46%), Positives = 12/26 (46%) Frame = +2 Query: 1208 PPPPPXXXXXXXXXXXXGGGGGGGGG 1285 PPPPP GG GGGG G Sbjct: 64 PPPPPPPLNWPTAGGGGGGSGGGGRG 89 Score = 29.5 bits (63), Expect = 6.0 Identities = 12/26 (46%), Positives = 12/26 (46%) Frame = +2 Query: 1208 PPPPPXXXXXXXXXXXXGGGGGGGGG 1285 PPPPP G GGGG GG Sbjct: 65 PPPPPPLNWPTAGGGGGGSGGGGRGG 90 >06_02_0175 - 12624608-12625297 Length = 229 Score = 31.5 bits (68), Expect = 1.5 Identities = 17/49 (34%), Positives = 17/49 (34%) Frame = +2 Query: 1139 GGGGGGGXXXXXXXXXXXXGXXXPPPPPXXXXXXXXXXXXGGGGGGGGG 1285 GGGGGGG G GGGGGGGGG Sbjct: 67 GGGGGGGGSSGGSSWSYGWGWGWGTDSGGGGSSGGGGGGGGGGGGGGGG 115 Score = 30.3 bits (65), Expect = 3.4 Identities = 17/49 (34%), Positives = 17/49 (34%) Frame = +2 Query: 1139 GGGGGGGXXXXXXXXXXXXGXXXPPPPPXXXXXXXXXXXXGGGGGGGGG 1285 GGGGGGG G GGGGGGGGG Sbjct: 65 GGGGGGGGGGSSGGSSWSYGWGWGWGTDSGGGGSSGGGGGGGGGGGGGG 113 >06_01_0760 - 5676973-5677830 Length = 285 Score = 31.5 bits (68), Expect = 1.5 Identities = 17/49 (34%), Positives = 17/49 (34%) Frame = +3 Query: 1140 GGGGGGGXXXXXXXXXXGXXXXPXPPXPXXXXXXXXXXXXGGGGGGGGG 1286 GGGGGGG G GGGGGGGGG Sbjct: 32 GGGGGGGGGGGGSGNGSGWGSGSGSGYGQSSGSGGAYASGGGGGGGGGG 80 >03_02_0436 + 8427018-8427707,8429005-8429544 Length = 409 Score = 31.5 bits (68), Expect = 1.5 Identities = 17/50 (34%), Positives = 17/50 (34%), Gaps = 4/50 (8%) Frame = -2 Query: 1281 PPP----PPPPPXXXXXXXXXXXXGGGGGXXXPXXXXXXXXXXXXPPPPP 1144 PPP PPP GGGGG P PPPPP Sbjct: 75 PPPIMCWPPPAQPVHGAIHHHHNLGGGGGQQSPFFPLLPPLPPQPPPPPP 124 Score = 29.1 bits (62), Expect = 7.9 Identities = 16/50 (32%), Positives = 16/50 (32%), Gaps = 4/50 (8%) Frame = -3 Query: 1277 PPP----PPPXXXXXXXXXXXXXXGGXGXXXPPXXXXXXXXXXPPPPPPP 1140 PPP PPP GG G P PPPPPP Sbjct: 75 PPPIMCWPPPAQPVHGAIHHHHNLGGGGGQQSPFFPLLPPLPPQPPPPPP 124 >02_04_0271 + 21445113-21445865,21446727-21446788,21446927-21447027, 21447165-21447248,21448054-21448058,21448193-21448267, 21448339-21448416,21448896-21448952,21449351-21449421, 21449529-21449628,21449758-21449862,21450004-21450066, 21450144-21450266,21450371-21450514,21450598-21450672 Length = 631 Score = 31.5 bits (68), Expect = 1.5 Identities = 13/26 (50%), Positives = 13/26 (50%) Frame = +2 Query: 1208 PPPPPXXXXXXXXXXXXGGGGGGGGG 1285 PP PP GGGGGGGGG Sbjct: 176 PPGPPFHPNLNVVRVAGGGGGGGGGG 201 >01_05_0490 + 22672241-22674679 Length = 812 Score = 31.5 bits (68), Expect = 1.5 Identities = 18/49 (36%), Positives = 18/49 (36%) Frame = -2 Query: 1284 PPPPPPPPPXXXXXXXXXXXXGGGGGXXXPXXXXXXXXXXXXPPPPPPP 1138 PPPPPPPPP GG PPPPPPP Sbjct: 607 PPPPPPPPP--SSIFYNLFKKGGS------KSRRIHSVAPPQPPPPPPP 647 Score = 29.5 bits (63), Expect = 6.0 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1284 PPPPPPPPP 1258 PPPPPPPPP Sbjct: 697 PPPPPPPPP 705 Score = 29.5 bits (63), Expect = 6.0 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1284 PPPPPPPPP 1258 PPPPPPPPP Sbjct: 698 PPPPPPPPP 706 Score = 29.1 bits (62), Expect = 7.9 Identities = 16/48 (33%), Positives = 16/48 (33%) Frame = -3 Query: 1283 PPPPPPPPXXXXXXXXXXXXXXGGXGXXXPPXXXXXXXXXXPPPPPPP 1140 P PPPPPP PP PPPPPPP Sbjct: 662 PAPPPPPPPQQQPPFYPRRAVVYYTYPLPPPSPPLPPP---PPPPPPP 706 >09_06_0277 - 21983049-21983080,21983250-21984788,21986619-21986655, 21987612-21987665,21987781-21987893,21988272-21988660, 21988783-21988903,21989245-21989342,21989963-21990153 Length = 857 Score = 25.8 bits (54), Expect(2) = 1.8 Identities = 8/9 (88%), Positives = 8/9 (88%) Frame = -2 Query: 1284 PPPPPPPPP 1258 PP PPPPPP Sbjct: 374 PPNPPPPPP 382 Score = 23.8 bits (49), Expect(2) = 1.8 Identities = 7/7 (100%), Positives = 7/7 (100%) Frame = -2 Query: 1158 PPPPPPP 1138 PPPPPPP Sbjct: 377 PPPPPPP 383 >03_05_0865 - 28365430-28367640 Length = 736 Score = 25.8 bits (54), Expect(2) = 1.8 Identities = 8/9 (88%), Positives = 8/9 (88%) Frame = -2 Query: 1284 PPPPPPPPP 1258 P PPPPPPP Sbjct: 46 PRPPPPPPP 54 Score = 23.8 bits (49), Expect(2) = 1.8 Identities = 7/7 (100%), Positives = 7/7 (100%) Frame = -2 Query: 1158 PPPPPPP 1138 PPPPPPP Sbjct: 49 PPPPPPP 55 >01_05_0329 - 21037980-21038378,21038517-21038737,21038827-21038905, 21039002-21039071,21039144-21039255,21039359-21039398, 21039482-21039676,21039925-21040044,21040684-21041106, 21042386-21042928 Length = 733 Score = 25.8 bits (54), Expect(2) = 1.8 Identities = 8/9 (88%), Positives = 8/9 (88%) Frame = -2 Query: 1284 PPPPPPPPP 1258 P PPPPPPP Sbjct: 90 PRPPPPPPP 98 Score = 23.8 bits (49), Expect(2) = 1.8 Identities = 7/7 (100%), Positives = 7/7 (100%) Frame = -2 Query: 1158 PPPPPPP 1138 PPPPPPP Sbjct: 93 PPPPPPP 99 >07_01_1207 + 11511754-11513865 Length = 703 Score = 25.8 bits (54), Expect(2) = 1.8 Identities = 8/9 (88%), Positives = 8/9 (88%) Frame = -2 Query: 1284 PPPPPPPPP 1258 P PPPPPPP Sbjct: 11 PRPPPPPPP 19 Score = 23.8 bits (49), Expect(2) = 1.8 Identities = 7/7 (100%), Positives = 7/7 (100%) Frame = -2 Query: 1158 PPPPPPP 1138 PPPPPPP Sbjct: 14 PPPPPPP 20 >03_04_0042 - 16743440-16743454,16743907-16744002,16744257-16744475, 16744830-16744910,16745092-16745187,16745981-16746045, 16746131-16746217,16746522-16746720 Length = 285 Score = 29.5 bits (63), Expect = 6.0 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1284 PPPPPPPPP 1258 PPPPPPPPP Sbjct: 17 PPPPPPPPP 25 Score = 25.8 bits (54), Expect(2) = 2.0 Identities = 8/9 (88%), Positives = 8/9 (88%) Frame = -2 Query: 1284 PPPPPPPPP 1258 P PPPPPPP Sbjct: 15 PRPPPPPPP 23 Score = 23.8 bits (49), Expect(2) = 2.0 Identities = 7/7 (100%), Positives = 7/7 (100%) Frame = -2 Query: 1158 PPPPPPP 1138 PPPPPPP Sbjct: 19 PPPPPPP 25 >12_02_0299 - 17051570-17052474,17053542-17053755 Length = 372 Score = 31.1 bits (67), Expect = 2.0 Identities = 16/48 (33%), Positives = 16/48 (33%) Frame = -3 Query: 1283 PPPPPPPPXXXXXXXXXXXXXXGGXGXXXPPXXXXXXXXXXPPPPPPP 1140 PP PPPPP PP PPPPPPP Sbjct: 286 PPSPPPPPPPAFPFPFPQLPPL----PHFPPLPSFYPSPPPPPPPPPP 329 Score = 29.5 bits (63), Expect = 6.0 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1284 PPPPPPPPP 1258 PPPPPPPPP Sbjct: 320 PPPPPPPPP 328 Score = 29.5 bits (63), Expect = 6.0 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1284 PPPPPPPPP 1258 PPPPPPPPP Sbjct: 321 PPPPPPPPP 329 Score = 29.5 bits (63), Expect = 6.0 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1284 PPPPPPPPP 1258 PPPPPPPPP Sbjct: 322 PPPPPPPPP 330 Score = 29.5 bits (63), Expect = 6.0 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1284 PPPPPPPPP 1258 PPPPPPPPP Sbjct: 323 PPPPPPPPP 331 Score = 29.5 bits (63), Expect = 6.0 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1284 PPPPPPPPP 1258 PPPPPPPPP Sbjct: 324 PPPPPPPPP 332 >09_02_0327 - 7284829-7284889,7284946-7286126 Length = 413 Score = 31.1 bits (67), Expect = 2.0 Identities = 15/49 (30%), Positives = 15/49 (30%) Frame = -2 Query: 1284 PPPPPPPPPXXXXXXXXXXXXGGGGGXXXPXXXXXXXXXXXXPPPPPPP 1138 PPPPPPPPP G P PPP P Sbjct: 55 PPPPPPPPPPPPPRGRRYYRRVSGDDLDVPSCSSSPSPPSDEENPPPNP 103 Score = 29.5 bits (63), Expect = 6.0 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1284 PPPPPPPPP 1258 PPPPPPPPP Sbjct: 53 PPPPPPPPP 61 Score = 29.5 bits (63), Expect = 6.0 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1284 PPPPPPPPP 1258 PPPPPPPPP Sbjct: 54 PPPPPPPPP 62 >07_01_0674 + 5047503-5047646,5047808-5047901,5048743-5048828, 5049380-5049429,5049517-5049586,5049668-5049749, 5049867-5050267,5050414-5050941,5051823-5052044 Length = 558 Score = 31.1 bits (67), Expect = 2.0 Identities = 15/48 (31%), Positives = 15/48 (31%) Frame = -3 Query: 1283 PPPPPPPPXXXXXXXXXXXXXXGGXGXXXPPXXXXXXXXXXPPPPPPP 1140 PPPPPPP PP PPPPPP Sbjct: 231 PPPPPPPKPANIAGAPGLPLPPPPPPPPGPPPREIVPGQTLLPPPPPP 278 Score = 30.3 bits (65), Expect = 3.4 Identities = 16/49 (32%), Positives = 16/49 (32%), Gaps = 2/49 (4%) Frame = -3 Query: 1283 PPPPPPP--PXXXXXXXXXXXXXXGGXGXXXPPXXXXXXXXXXPPPPPP 1143 PPPPPPP P PP PPPPPP Sbjct: 230 PPPPPPPPKPANIAGAPGLPLPPPPPPPPGPPPREIVPGQTLLPPPPPP 278 >06_01_0690 + 5033943-5034740 Length = 265 Score = 31.1 bits (67), Expect = 2.0 Identities = 17/49 (34%), Positives = 17/49 (34%) Frame = +3 Query: 1140 GGGGGGGXXXXXXXXXXGXXXXPXPPXPXXXXXXXXXXXXGGGGGGGGG 1286 GGGGGGG G GGGGGGGGG Sbjct: 33 GGGGGGGGGGSGNGSGWGSGSGSGYGQASGPGGYASGGGGGGGGGGGGG 81 Score = 31.1 bits (67), Expect = 2.0 Identities = 17/49 (34%), Positives = 17/49 (34%) Frame = +3 Query: 1140 GGGGGGGXXXXXXXXXXGXXXXPXPPXPXXXXXXXXXXXXGGGGGGGGG 1286 GGGGGGG G GGGGGGGGG Sbjct: 113 GGGGGGGGQNGGSGYGSGSGSGYGQAGGYGPYGGGAYAQGGGGGGGGGG 161 Score = 31.1 bits (67), Expect = 2.0 Identities = 17/49 (34%), Positives = 17/49 (34%) Frame = +2 Query: 1139 GGGGGGGXXXXXXXXXXXXGXXXPPPPPXXXXXXXXXXXXGGGGGGGGG 1285 GGGGGGG G GGGGGGGGG Sbjct: 153 GGGGGGGGGGQNGGSGYGSGSGYGQAGGYGPYGGGYAQGGGGGGGGGGG 201 Score = 30.7 bits (66), Expect = 2.6 Identities = 17/49 (34%), Positives = 17/49 (34%) Frame = +2 Query: 1139 GGGGGGGXXXXXXXXXXXXGXXXPPPPPXXXXXXXXXXXXGGGGGGGGG 1285 GGGGGGG G GGGGGGGGG Sbjct: 71 GGGGGGGGGGGNGGSGYGSGSGSGYGQAGGYGPYGGYAQGGGGGGGGGG 119 Score = 30.3 bits (65), Expect = 3.4 Identities = 17/49 (34%), Positives = 17/49 (34%) Frame = +2 Query: 1139 GGGGGGGXXXXXXXXXXXXGXXXPPPPPXXXXXXXXXXXXGGGGGGGGG 1285 GGGGGGG G GGGGGGGGG Sbjct: 31 GGGGGGGGGGGGSGNGSGWGSGSGSGYGQASGPGGYASGGGGGGGGGGG 79 >05_01_0384 + 2997465-2999777,2999960-3000035,3003027-3003102, 3003571-3004442,3004592-3004773,3005206-3005295, 3005388-3005675,3005776-3005997,3006053-3006133, 3006634-3006861 Length = 1475 Score = 31.1 bits (67), Expect = 2.0 Identities = 12/30 (40%), Positives = 12/30 (40%) Frame = -2 Query: 1284 PPPPPPPPPXXXXXXXXXXXXGGGGGXXXP 1195 PPPPPPPPP G G P Sbjct: 582 PPPPPPPPPAAGNNNNNVANAGAAGNTAGP 611 Score = 29.5 bits (63), Expect = 6.0 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1284 PPPPPPPPP 1258 PPPPPPPPP Sbjct: 579 PPPPPPPPP 587 Score = 29.5 bits (63), Expect = 6.0 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1284 PPPPPPPPP 1258 PPPPPPPPP Sbjct: 580 PPPPPPPPP 588 Score = 29.5 bits (63), Expect = 6.0 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1284 PPPPPPPPP 1258 PPPPPPPPP Sbjct: 581 PPPPPPPPP 589 >02_05_0002 - 24849189-24849825,24850267-24850328 Length = 232 Score = 29.5 bits (63), Expect = 6.0 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1284 PPPPPPPPP 1258 PPPPPPPPP Sbjct: 218 PPPPPPPPP 226 Score = 25.8 bits (54), Expect(2) = 2.0 Identities = 8/9 (88%), Positives = 8/9 (88%) Frame = -2 Query: 1284 PPPPPPPPP 1258 P PPPPPPP Sbjct: 216 PHPPPPPPP 224 Score = 23.8 bits (49), Expect(2) = 2.0 Identities = 7/7 (100%), Positives = 7/7 (100%) Frame = -2 Query: 1158 PPPPPPP 1138 PPPPPPP Sbjct: 219 PPPPPPP 225 >08_01_0539 + 4679392-4681282,4682060-4682104,4682403-4683560, 4683834-4684204,4684290-4684835,4684927-4685027, 4685117-4685933,4686025-4686213,4686313-4686384, 4686477-4686587,4686647-4686652,4686694-4686794, 4687714-4687813,4687891-4687986,4688157-4688273, 4688367-4688492,4688566-4688619,4688745-4688992, 4689087-4689195,4689284-4689583,4689799-4689963 Length = 2240 Score = 29.5 bits (63), Expect = 6.0 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1284 PPPPPPPPP 1258 PPPPPPPPP Sbjct: 431 PPPPPPPPP 439 Score = 29.5 bits (63), Expect = 6.0 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1284 PPPPPPPPP 1258 PPPPPPPPP Sbjct: 432 PPPPPPPPP 440 Score = 29.5 bits (63), Expect = 6.0 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1284 PPPPPPPPP 1258 PPPPPPPPP Sbjct: 433 PPPPPPPPP 441 Score = 29.5 bits (63), Expect = 6.0 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1284 PPPPPPPPP 1258 PPPPPPPPP Sbjct: 434 PPPPPPPPP 442 Score = 29.5 bits (63), Expect = 6.0 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1284 PPPPPPPPP 1258 PPPPPPPPP Sbjct: 435 PPPPPPPPP 443 Score = 25.4 bits (53), Expect(2) = 2.2 Identities = 8/9 (88%), Positives = 8/9 (88%) Frame = -2 Query: 1284 PPPPPPPPP 1258 PPPPP PPP Sbjct: 425 PPPPPLPPP 433 Score = 23.8 bits (49), Expect(2) = 2.2 Identities = 7/7 (100%), Positives = 7/7 (100%) Frame = -2 Query: 1158 PPPPPPP 1138 PPPPPPP Sbjct: 433 PPPPPPP 439 >07_01_0516 - 3850252-3852870 Length = 872 Score = 29.5 bits (63), Expect = 6.0 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1284 PPPPPPPPP 1258 PPPPPPPPP Sbjct: 27 PPPPPPPPP 35 Score = 25.4 bits (53), Expect(2) = 2.3 Identities = 8/9 (88%), Positives = 8/9 (88%) Frame = -2 Query: 1284 PPPPPPPPP 1258 P PPPPPPP Sbjct: 25 PLPPPPPPP 33 Score = 23.8 bits (49), Expect(2) = 2.3 Identities = 7/7 (100%), Positives = 7/7 (100%) Frame = -2 Query: 1158 PPPPPPP 1138 PPPPPPP Sbjct: 29 PPPPPPP 35 >07_01_1123 - 10385215-10385574,10385676-10385810,10386385-10387091, 10387158-10387455 Length = 499 Score = 29.5 bits (63), Expect = 6.0 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1284 PPPPPPPPP 1258 PPPPPPPPP Sbjct: 9 PPPPPPPPP 17 Score = 25.4 bits (53), Expect(2) = 2.4 Identities = 8/9 (88%), Positives = 8/9 (88%) Frame = -2 Query: 1284 PPPPPPPPP 1258 PP PPPPPP Sbjct: 6 PPIPPPPPP 14 Score = 23.8 bits (49), Expect(2) = 2.4 Identities = 7/7 (100%), Positives = 7/7 (100%) Frame = -2 Query: 1158 PPPPPPP 1138 PPPPPPP Sbjct: 9 PPPPPPP 15 >01_05_0307 - 20701860-20702168,20702291-20703083,20703183-20703278, 20703391-20703518 Length = 441 Score = 25.4 bits (53), Expect(2) = 2.5 Identities = 8/9 (88%), Positives = 8/9 (88%) Frame = -2 Query: 1284 PPPPPPPPP 1258 P PPPPPPP Sbjct: 253 PLPPPPPPP 261 Score = 23.8 bits (49), Expect(2) = 2.5 Identities = 7/7 (100%), Positives = 7/7 (100%) Frame = -2 Query: 1158 PPPPPPP 1138 PPPPPPP Sbjct: 256 PPPPPPP 262 >06_01_0835 - 6315762-6316844 Length = 360 Score = 25.4 bits (53), Expect(2) = 2.5 Identities = 8/9 (88%), Positives = 8/9 (88%) Frame = -2 Query: 1284 PPPPPPPPP 1258 P PPPPPPP Sbjct: 312 PLPPPPPPP 320 Score = 23.8 bits (49), Expect(2) = 2.5 Identities = 7/7 (100%), Positives = 7/7 (100%) Frame = -2 Query: 1158 PPPPPPP 1138 PPPPPPP Sbjct: 315 PPPPPPP 321 >12_01_0838 - 7830944-7831444 Length = 166 Score = 30.7 bits (66), Expect = 2.6 Identities = 17/49 (34%), Positives = 17/49 (34%) Frame = +2 Query: 1139 GGGGGGGXXXXXXXXXXXXGXXXPPPPPXXXXXXXXXXXXGGGGGGGGG 1285 GGGGGGG G GGGGGGGGG Sbjct: 76 GGGGGGGGGSNGSGSGSGYGYGYGQGNGGAQGQGSGGGGGGGGGGGGGG 124 Score = 29.5 bits (63), Expect = 6.0 Identities = 17/49 (34%), Positives = 17/49 (34%) Frame = +2 Query: 1139 GGGGGGGXXXXXXXXXXXXGXXXPPPPPXXXXXXXXXXXXGGGGGGGGG 1285 GGGGGGG G GGGGGGGGG Sbjct: 35 GGGGGGGGGGGGGGNGSGSGSGYGYNYGKGGGQSGGGQGSGGGGGGGGG 83 >12_01_0347 + 2658545-2659309 Length = 254 Score = 30.7 bits (66), Expect = 2.6 Identities = 18/48 (37%), Positives = 18/48 (37%) Frame = +2 Query: 1142 GGGGGGXXXXXXXXXXXXGXXXPPPPPXXXXXXXXXXXXGGGGGGGGG 1285 GGGGGG G P P GGGGGGGGG Sbjct: 53 GGGGGGNSSQRFS-----GNLKPTAAPIIGLSRKLGHGGGGGGGGGGG 95 Score = 29.5 bits (63), Expect = 6.0 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1284 PPPPPPPPP 1258 PPPPPPPPP Sbjct: 188 PPPPPPPPP 196 >07_03_0792 - 21541301-21542143,21542426-21542661,21543177-21543373, 21543459-21544173,21544250-21544892,21545970-21546139, 21546442-21546943 Length = 1101 Score = 30.7 bits (66), Expect = 2.6 Identities = 15/49 (30%), Positives = 15/49 (30%) Frame = -2 Query: 1284 PPPPPPPPPXXXXXXXXXXXXGGGGGXXXPXXXXXXXXXXXXPPPPPPP 1138 PPP P PPP G G P PPPP P Sbjct: 585 PPPEPSPPPAPKAAPPPPPPKSTGPGPPRPPPPAMPGSSKTRPPPPLKP 633 >07_03_0177 - 14770777-14772045 Length = 422 Score = 30.7 bits (66), Expect = 2.6 Identities = 17/49 (34%), Positives = 17/49 (34%) Frame = +2 Query: 1139 GGGGGGGXXXXXXXXXXXXGXXXPPPPPXXXXXXXXXXXXGGGGGGGGG 1285 GGGGGGG G GGGGGGGGG Sbjct: 368 GGGGGGGGGGFGGGGGSGIGGGFGKGGGFGFGVGGGGFGGGGGGGGGGG 416 >06_03_0790 - 24636805-24637770 Length = 321 Score = 30.7 bits (66), Expect = 2.6 Identities = 17/49 (34%), Positives = 17/49 (34%) Frame = +3 Query: 1140 GGGGGGGXXXXXXXXXXGXXXXPXPPXPXXXXXXXXXXXXGGGGGGGGG 1286 GGGGGGG G GGGGGGGGG Sbjct: 82 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGRGGGGGGGGG 130 Score = 30.7 bits (66), Expect = 2.6 Identities = 17/49 (34%), Positives = 17/49 (34%) Frame = +3 Query: 1140 GGGGGGGXXXXXXXXXXGXXXXPXPPXPXXXXXXXXXXXXGGGGGGGGG 1286 GGGGGGG G GGGGGGGGG Sbjct: 83 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGRGGGGGGGGGG 131 Score = 30.7 bits (66), Expect = 2.6 Identities = 17/49 (34%), Positives = 17/49 (34%) Frame = +3 Query: 1140 GGGGGGGXXXXXXXXXXGXXXXPXPPXPXXXXXXXXXXXXGGGGGGGGG 1286 GGGGGGG G GGGGGGGGG Sbjct: 85 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGRGGGGGGGGGGGG 133 Score = 30.7 bits (66), Expect = 2.6 Identities = 17/49 (34%), Positives = 17/49 (34%) Frame = +3 Query: 1140 GGGGGGGXXXXXXXXXXGXXXXPXPPXPXXXXXXXXXXXXGGGGGGGGG 1286 GGGGGGG G GGGGGGGGG Sbjct: 93 GGGGGGGGGGGGGGGGGGGGGGGGGGGGRGGGGGGGGGGGGGGGGGGGG 141 Score = 30.7 bits (66), Expect = 2.6 Identities = 17/49 (34%), Positives = 17/49 (34%) Frame = +3 Query: 1140 GGGGGGGXXXXXXXXXXGXXXXPXPPXPXXXXXXXXXXXXGGGGGGGGG 1286 GGGGGGG G GGGGGGGGG Sbjct: 94 GGGGGGGGGGGGGGGGGGGGGGGGGGGRGGGGGGGGGGGGGGGGGGGGG 142 Score = 30.3 bits (65), Expect = 3.4 Identities = 17/49 (34%), Positives = 17/49 (34%) Frame = +2 Query: 1139 GGGGGGGXXXXXXXXXXXXGXXXPPPPPXXXXXXXXXXXXGGGGGGGGG 1285 GGGGGGG G GGGGGGGGG Sbjct: 84 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGRGGGGGGGGGGG 132 Score = 30.3 bits (65), Expect = 3.4 Identities = 17/49 (34%), Positives = 17/49 (34%) Frame = +2 Query: 1139 GGGGGGGXXXXXXXXXXXXGXXXPPPPPXXXXXXXXXXXXGGGGGGGGG 1285 GGGGGGG G GGGGGGGGG Sbjct: 86 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGRGGGGGGGGGGGGG 134 Score = 30.3 bits (65), Expect = 3.4 Identities = 17/49 (34%), Positives = 17/49 (34%) Frame = +2 Query: 1139 GGGGGGGXXXXXXXXXXXXGXXXPPPPPXXXXXXXXXXXXGGGGGGGGG 1285 GGGGGGG G GGGGGGGGG Sbjct: 87 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGRGGGGGGGGGGGGGG 135 Score = 30.3 bits (65), Expect = 3.4 Identities = 17/49 (34%), Positives = 17/49 (34%) Frame = +2 Query: 1139 GGGGGGGXXXXXXXXXXXXGXXXPPPPPXXXXXXXXXXXXGGGGGGGGG 1285 GGGGGGG G GGGGGGGGG Sbjct: 88 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGRGGGGGGGGGGGGGGG 136 Score = 30.3 bits (65), Expect = 3.4 Identities = 17/49 (34%), Positives = 17/49 (34%) Frame = +2 Query: 1139 GGGGGGGXXXXXXXXXXXXGXXXPPPPPXXXXXXXXXXXXGGGGGGGGG 1285 GGGGGGG G GGGGGGGGG Sbjct: 89 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGRGGGGGGGGGGGGGGGG 137 Score = 30.3 bits (65), Expect = 3.4 Identities = 17/49 (34%), Positives = 17/49 (34%) Frame = +2 Query: 1139 GGGGGGGXXXXXXXXXXXXGXXXPPPPPXXXXXXXXXXXXGGGGGGGGG 1285 GGGGGGG G GGGGGGGGG Sbjct: 90 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGRGGGGGGGGGGGGGGGGG 138 Score = 30.3 bits (65), Expect = 3.4 Identities = 17/49 (34%), Positives = 17/49 (34%) Frame = +2 Query: 1139 GGGGGGGXXXXXXXXXXXXGXXXPPPPPXXXXXXXXXXXXGGGGGGGGG 1285 GGGGGGG G GGGGGGGGG Sbjct: 91 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGRGGGGGGGGGGGGGGGGGG 139 Score = 30.3 bits (65), Expect = 3.4 Identities = 17/49 (34%), Positives = 17/49 (34%) Frame = +2 Query: 1139 GGGGGGGXXXXXXXXXXXXGXXXPPPPPXXXXXXXXXXXXGGGGGGGGG 1285 GGGGGGG G GGGGGGGGG Sbjct: 92 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGRGGGGGGGGGGGGGGGGGGG 140 Score = 30.3 bits (65), Expect = 3.4 Identities = 17/49 (34%), Positives = 17/49 (34%) Frame = +2 Query: 1139 GGGGGGGXXXXXXXXXXXXGXXXPPPPPXXXXXXXXXXXXGGGGGGGGG 1285 GGGGGGG G GGGGGGGGG Sbjct: 95 GGGGGGGGGGGGGGGGGGGGGGGGGGRGGGGGGGGGGGGGGGGGGGGGG 143 Score = 30.3 bits (65), Expect = 3.4 Identities = 17/49 (34%), Positives = 17/49 (34%) Frame = +2 Query: 1139 GGGGGGGXXXXXXXXXXXXGXXXPPPPPXXXXXXXXXXXXGGGGGGGGG 1285 GGGGGGG G GGGGGGGGG Sbjct: 96 GGGGGGGGGGGGGGGGGGGGGGGGGRGGGGGGGGGGGGGGGGGGGGGGG 144 Score = 30.3 bits (65), Expect = 3.4 Identities = 17/49 (34%), Positives = 17/49 (34%) Frame = +2 Query: 1139 GGGGGGGXXXXXXXXXXXXGXXXPPPPPXXXXXXXXXXXXGGGGGGGGG 1285 GGGGGGG G GGGGGGGGG Sbjct: 97 GGGGGGGGGGGGGGGGGGGGGGGGRGGGGGGGGGGGGGGGGGGGGGGGG 145 Score = 30.3 bits (65), Expect = 3.4 Identities = 17/49 (34%), Positives = 17/49 (34%) Frame = +2 Query: 1139 GGGGGGGXXXXXXXXXXXXGXXXPPPPPXXXXXXXXXXXXGGGGGGGGG 1285 GGGGGGG G GGGGGGGGG Sbjct: 98 GGGGGGGGGGGGGGGGGGGGGGGRGGGGGGGGGGGGGGGGGGGGGGGGG 146 Score = 30.3 bits (65), Expect = 3.4 Identities = 17/49 (34%), Positives = 17/49 (34%) Frame = +2 Query: 1139 GGGGGGGXXXXXXXXXXXXGXXXPPPPPXXXXXXXXXXXXGGGGGGGGG 1285 GGGGGGG G GGGGGGGGG Sbjct: 99 GGGGGGGGGGGGGGGGGGGGGGRGGGGGGGGGGGGGGGGGGGGGGGGGG 147 >02_04_0400 - 22608519-22608844,22609044-22609122 Length = 134 Score = 30.7 bits (66), Expect = 2.6 Identities = 17/49 (34%), Positives = 17/49 (34%) Frame = +3 Query: 1140 GGGGGGGXXXXXXXXXXGXXXXPXPPXPXXXXXXXXXXXXGGGGGGGGG 1286 GGGGGGG G GGGGGGGGG Sbjct: 34 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGRGGGGGGGGGGGGGGGGGG 82 Score = 30.7 bits (66), Expect = 2.6 Identities = 17/49 (34%), Positives = 17/49 (34%) Frame = +3 Query: 1140 GGGGGGGXXXXXXXXXXGXXXXPXPPXPXXXXXXXXXXXXGGGGGGGGG 1286 GGGGGGG G GGGGGGGGG Sbjct: 38 GGGGGGGGGGGGGGGGGGGGGGGGGGRGGGGGGGGGGGGGGGGGGGGGG 86 Score = 30.7 bits (66), Expect = 2.6 Identities = 17/49 (34%), Positives = 17/49 (34%) Frame = +3 Query: 1140 GGGGGGGXXXXXXXXXXGXXXXPXPPXPXXXXXXXXXXXXGGGGGGGGG 1286 GGGGGGG G GGGGGGGGG Sbjct: 39 GGGGGGGGGGGGGGGGGGGGGGGGGRGGGGGGGGGGGGGGGGGGGGGGG 87 Score = 30.7 bits (66), Expect = 2.6 Identities = 17/49 (34%), Positives = 17/49 (34%) Frame = +3 Query: 1140 GGGGGGGXXXXXXXXXXGXXXXPXPPXPXXXXXXXXXXXXGGGGGGGGG 1286 GGGGGGG G GGGGGGGGG Sbjct: 40 GGGGGGGGGGGGGGGGGGGGGGGGRGGGGGGGGGGGGGGGGGGGGGGGG 88 Score = 30.7 bits (66), Expect = 2.6 Identities = 17/49 (34%), Positives = 17/49 (34%) Frame = +3 Query: 1140 GGGGGGGXXXXXXXXXXGXXXXPXPPXPXXXXXXXXXXXXGGGGGGGGG 1286 GGGGGGG G GGGGGGGGG Sbjct: 41 GGGGGGGGGGGGGGGGGGGGGGGRGGGGGGGGGGGGGGGGGGGGGGGGG 89 Score = 30.7 bits (66), Expect = 2.6 Identities = 17/49 (34%), Positives = 17/49 (34%) Frame = +3 Query: 1140 GGGGGGGXXXXXXXXXXGXXXXPXPPXPXXXXXXXXXXXXGGGGGGGGG 1286 GGGGGGG G GGGGGGGGG Sbjct: 42 GGGGGGGGGGGGGGGGGGGGGGRGGGGGGGGGGGGGGGGGGGGGGGGGG 90 Score = 30.7 bits (66), Expect = 2.6 Identities = 17/49 (34%), Positives = 17/49 (34%) Frame = +3 Query: 1140 GGGGGGGXXXXXXXXXXGXXXXPXPPXPXXXXXXXXXXXXGGGGGGGGG 1286 GGGGGGG G GGGGGGGGG Sbjct: 44 GGGGGGGGGGGGGGGGGGGGRGGGGGGGGGGGGGGGGGGGGGGGGGGGG 92 Score = 30.3 bits (65), Expect = 3.4 Identities = 17/49 (34%), Positives = 17/49 (34%) Frame = +2 Query: 1139 GGGGGGGXXXXXXXXXXXXGXXXPPPPPXXXXXXXXXXXXGGGGGGGGG 1285 GGGGGGG G GGGGGGGGG Sbjct: 35 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGRGGGGGGGGGGGGGGGGGGG 83 Score = 30.3 bits (65), Expect = 3.4 Identities = 17/49 (34%), Positives = 17/49 (34%) Frame = +2 Query: 1139 GGGGGGGXXXXXXXXXXXXGXXXPPPPPXXXXXXXXXXXXGGGGGGGGG 1285 GGGGGGG G GGGGGGGGG Sbjct: 36 GGGGGGGGGGGGGGGGGGGGGGGGGGGGRGGGGGGGGGGGGGGGGGGGG 84 Score = 30.3 bits (65), Expect = 3.4 Identities = 17/49 (34%), Positives = 17/49 (34%) Frame = +2 Query: 1139 GGGGGGGXXXXXXXXXXXXGXXXPPPPPXXXXXXXXXXXXGGGGGGGGG 1285 GGGGGGG G GGGGGGGGG Sbjct: 37 GGGGGGGGGGGGGGGGGGGGGGGGGGGRGGGGGGGGGGGGGGGGGGGGG 85 Score = 30.3 bits (65), Expect = 3.4 Identities = 17/49 (34%), Positives = 17/49 (34%) Frame = +2 Query: 1139 GGGGGGGXXXXXXXXXXXXGXXXPPPPPXXXXXXXXXXXXGGGGGGGGG 1285 GGGGGGG G GGGGGGGGG Sbjct: 43 GGGGGGGGGGGGGGGGGGGGGRGGGGGGGGGGGGGGGGGGGGGGGGGGG 91 >02_02_0307 - 8809724-8811589,8811681-8811762,8812130-8812242, 8812361-8812492,8812681-8812864,8813002-8813135, 8813552-8813656,8813738-8813839,8813930-8814022, 8814136-8814456,8814595-8814696,8814791-8814853, 8815213-8815708,8815964-8816124,8816213-8816743, 8817077-8817118,8817203-8817334,8817639-8817703, 8817858-8818169,8818262-8818334,8818425-8818517, 8819440-8819501,8819740-8819809 Length = 1777 Score = 30.7 bits (66), Expect = 2.6 Identities = 12/25 (48%), Positives = 12/25 (48%) Frame = -2 Query: 1281 PPPPPPPPXXXXXXXXXXXXGGGGG 1207 PPPPPPP GGGGG Sbjct: 144 PPPPPPPASPDAAKTPGSPAGGGGG 168 >07_03_1771 - 29404972-29405175,29405282-29405677 Length = 199 Score = 29.5 bits (63), Expect = 6.0 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1284 PPPPPPPPP 1258 PPPPPPPPP Sbjct: 16 PPPPPPPPP 24 Score = 29.5 bits (63), Expect = 6.0 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1284 PPPPPPPPP 1258 PPPPPPPPP Sbjct: 17 PPPPPPPPP 25 Score = 25.4 bits (53), Expect(2) = 2.6 Identities = 8/9 (88%), Positives = 8/9 (88%) Frame = -2 Query: 1284 PPPPPPPPP 1258 P PPPPPPP Sbjct: 14 PLPPPPPPP 22 Score = 23.8 bits (49), Expect(2) = 2.6 Identities = 7/7 (100%), Positives = 7/7 (100%) Frame = -2 Query: 1158 PPPPPPP 1138 PPPPPPP Sbjct: 17 PPPPPPP 23 >10_08_0630 - 19410852-19411235,19411370-19412257,19412440-19412941, 19413662-19414135,19414982-19415040,19415468-19415629 Length = 822 Score = 27.9 bits (59), Expect(2) = 3.0 Identities = 17/48 (35%), Positives = 17/48 (35%) Frame = +3 Query: 1143 GGGGGGXXXXXXXXXXGXXXXPXPPXPXXXXXXXXXXXXGGGGGGGGG 1286 GGGGGG P P GGGGGGGGG Sbjct: 132 GGGGGGRISM------AEAASPISSRPPPAQQQFDELGVGGGGGGGGG 173 Score = 21.0 bits (42), Expect(2) = 3.0 Identities = 7/7 (100%), Positives = 7/7 (100%) Frame = +3 Query: 1140 GGGGGGG 1160 GGGGGGG Sbjct: 93 GGGGGGG 99 >04_01_0034 - 401208-402923 Length = 571 Score = 25.4 bits (53), Expect(2) = 3.1 Identities = 9/19 (47%), Positives = 9/19 (47%) Frame = -3 Query: 1196 PPXXXXXXXXXXPPPPPPP 1140 PP PPPPPPP Sbjct: 310 PPPQQQRAKPSRPPPPPPP 328 Score = 23.4 bits (48), Expect(2) = 3.1 Identities = 7/8 (87%), Positives = 7/8 (87%) Frame = -3 Query: 1283 PPPPPPPP 1260 P PPPPPP Sbjct: 305 PAPPPPPP 312 >02_05_1120 + 34257504-34258294,34258483-34258571,34258616-34258713, 34259269-34259292,34259314-34259404,34259761-34259813, 34259933-34260151 Length = 454 Score = 25.0 bits (52), Expect(2) = 3.2 Identities = 8/9 (88%), Positives = 8/9 (88%) Frame = -2 Query: 1284 PPPPPPPPP 1258 PP PPPPPP Sbjct: 28 PPFPPPPPP 36 Score = 23.8 bits (49), Expect(2) = 3.2 Identities = 7/7 (100%), Positives = 7/7 (100%) Frame = -2 Query: 1158 PPPPPPP 1138 PPPPPPP Sbjct: 31 PPPPPPP 37 >05_01_0380 + 2978256-2979284 Length = 342 Score = 29.5 bits (63), Expect = 6.0 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1284 PPPPPPPPP 1258 PPPPPPPPP Sbjct: 26 PPPPPPPPP 34 Score = 29.5 bits (63), Expect = 6.0 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1284 PPPPPPPPP 1258 PPPPPPPPP Sbjct: 27 PPPPPPPPP 35 Score = 29.5 bits (63), Expect = 6.0 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1284 PPPPPPPPP 1258 PPPPPPPPP Sbjct: 28 PPPPPPPPP 36 Score = 29.5 bits (63), Expect = 6.0 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1284 PPPPPPPPP 1258 PPPPPPPPP Sbjct: 29 PPPPPPPPP 37 Score = 29.5 bits (63), Expect = 6.0 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1284 PPPPPPPPP 1258 PPPPPPPPP Sbjct: 30 PPPPPPPPP 38 Score = 29.5 bits (63), Expect = 6.0 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1284 PPPPPPPPP 1258 PPPPPPPPP Sbjct: 31 PPPPPPPPP 39 Score = 29.5 bits (63), Expect = 6.0 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1284 PPPPPPPPP 1258 PPPPPPPPP Sbjct: 32 PPPPPPPPP 40 Score = 29.5 bits (63), Expect = 6.0 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1284 PPPPPPPPP 1258 PPPPPPPPP Sbjct: 33 PPPPPPPPP 41 Score = 24.6 bits (51), Expect(2) = 3.3 Identities = 8/15 (53%), Positives = 9/15 (60%) Frame = +3 Query: 933 PPPPPPPXXXXXKKK 977 PPPPPPP +K Sbjct: 33 PPPPPPPPPRPFSRK 47 Score = 24.2 bits (50), Expect(2) = 3.3 Identities = 7/9 (77%), Positives = 8/9 (88%) Frame = +3 Query: 927 KXPPPPPPP 953 + PPPPPPP Sbjct: 24 RMPPPPPPP 32 >12_02_1174 - 26696869-26698191 Length = 440 Score = 30.3 bits (65), Expect = 3.4 Identities = 16/48 (33%), Positives = 16/48 (33%) Frame = -2 Query: 1284 PPPPPPPPPXXXXXXXXXXXXGGGGGXXXPXXXXXXXXXXXXPPPPPP 1141 PPPPPPPPP P PPPPPP Sbjct: 154 PPPPPPPPPPPPRPPSVKPP------VVQPKPQPPPSLQPPSPPPPPP 195 Score = 29.9 bits (64), Expect = 4.5 Identities = 16/47 (34%), Positives = 16/47 (34%) Frame = -3 Query: 1283 PPPPPPPPXXXXXXXXXXXXXXGGXGXXXPPXXXXXXXXXXPPPPPP 1143 PPPPPPPP PP PPPPPP Sbjct: 153 PPPPPPPPPPPPPRPPSVKPPVVQPKPQPPPSLQPPS----PPPPPP 195 >11_01_0498 - 3828516-3829058 Length = 180 Score = 30.3 bits (65), Expect = 3.4 Identities = 12/25 (48%), Positives = 12/25 (48%) Frame = +2 Query: 1208 PPPPPXXXXXXXXXXXXGGGGGGGG 1282 PPPPP GGGGG GG Sbjct: 16 PPPPPAAAESDQRREEDGGGGGAGG 40 >10_08_0221 - 15980370-15980927 Length = 185 Score = 30.3 bits (65), Expect = 3.4 Identities = 17/49 (34%), Positives = 17/49 (34%) Frame = +2 Query: 1139 GGGGGGGXXXXXXXXXXXXGXXXPPPPPXXXXXXXXXXXXGGGGGGGGG 1285 GGGGGGG G GGGGGGGGG Sbjct: 30 GGGGGGGGGGGGSNGGSGWGSGSGSGYGQASGDGSYASGDGGGGGGGGG 78 >10_08_0217 - 15962192-15962884 Length = 230 Score = 30.3 bits (65), Expect = 3.4 Identities = 17/49 (34%), Positives = 17/49 (34%) Frame = +2 Query: 1139 GGGGGGGXXXXXXXXXXXXGXXXPPPPPXXXXXXXXXXXXGGGGGGGGG 1285 GGGGGGG G GGGGGGGGG Sbjct: 32 GGGGGGGGGGGGSGNGSGWGSGSGSGYGQAGGSGGAYASGGGGGGGGGG 80 >10_08_0213 - 15912048-15912716 Length = 222 Score = 30.3 bits (65), Expect = 3.4 Identities = 17/49 (34%), Positives = 17/49 (34%) Frame = +2 Query: 1139 GGGGGGGXXXXXXXXXXXXGXXXPPPPPXXXXXXXXXXXXGGGGGGGGG 1285 GGGGGGG G GGGGGGGGG Sbjct: 36 GGGGGGGGGSGGGGGYGGSGYGSGSGYGEGGGAGAGGYGHGGGGGGGGG 84 >09_06_0107 + 20907560-20908491,20908511-20908625,20908967-20909058, 20909293-20909556,20910714-20911494 Length = 727 Score = 30.3 bits (65), Expect = 3.4 Identities = 16/49 (32%), Positives = 16/49 (32%) Frame = -2 Query: 1284 PPPPPPPPPXXXXXXXXXXXXGGGGGXXXPXXXXXXXXXXXXPPPPPPP 1138 PPPPPPPPP PPPPPPP Sbjct: 82 PPPPPPPPPPPPPPLSPTPTT-----TSWTTNSSSISASPILPPPPPPP 125 >03_05_0501 - 24944533-24945507 Length = 324 Score = 30.3 bits (65), Expect = 3.4 Identities = 12/24 (50%), Positives = 12/24 (50%) Frame = +2 Query: 1208 PPPPPXXXXXXXXXXXXGGGGGGG 1279 PPPPP GGGGGGG Sbjct: 36 PPPPPKAPCRSQEEQPDGGGGGGG 59 >02_05_1057 + 33809982-33810366,33810436-33810687,33810727-33810926, 33811021-33811122 Length = 312 Score = 30.3 bits (65), Expect = 3.4 Identities = 17/49 (34%), Positives = 17/49 (34%) Frame = +3 Query: 1140 GGGGGGGXXXXXXXXXXGXXXXPXPPXPXXXXXXXXXXXXGGGGGGGGG 1286 GGGGGGG G GGGGGGGGG Sbjct: 47 GGGGGGGGGGTGDACSPGTAEGGCGGGCGGENDDTGNGGGGGGGGGGGG 95 >12_01_0399 + 3152219-3152721,3152995-3153127,3155013-3155097, 3155321-3155586 Length = 328 Score = 25.8 bits (54), Expect(2) = 4.2 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = +2 Query: 1259 GGGGGGGGG 1285 GGGGGGGGG Sbjct: 104 GGGGGGGGG 112 Score = 22.6 bits (46), Expect(2) = 4.2 Identities = 9/15 (60%), Positives = 9/15 (60%) Frame = +2 Query: 1115 FFFXXXXXGGGGGGG 1159 FF GGGGGGG Sbjct: 95 FFEGFSLQGGGGGGG 109 >12_02_1122 - 26244667-26245299 Length = 210 Score = 25.0 bits (52), Expect(2) = 4.4 Identities = 11/29 (37%), Positives = 11/29 (37%) Frame = +2 Query: 1196 GXXXPPPPPXXXXXXXXXXXXGGGGGGGG 1282 G PPP P GGGG GG Sbjct: 24 GLTSPPPSPGGASPSIPPGRGGGGGTSGG 52 Score = 23.4 bits (48), Expect(2) = 4.4 Identities = 8/9 (88%), Positives = 8/9 (88%) Frame = +2 Query: 1259 GGGGGGGGG 1285 GGG GGGGG Sbjct: 60 GGGNGGGGG 68 >12_02_1036 - 25587313-25587890,25589209-25589272,25589356-25589448, 25589533-25589683,25590474-25590539,25590594-25590907 Length = 421 Score = 29.9 bits (64), Expect = 4.5 Identities = 16/49 (32%), Positives = 16/49 (32%) Frame = -2 Query: 1284 PPPPPPPPPXXXXXXXXXXXXGGGGGXXXPXXXXXXXXXXXXPPPPPPP 1138 P PPPPPP G P PPPPPPP Sbjct: 7 PAKPPPPPP--------PQLEASGSDPDDPLLRDRVVVIAPPPPPPPPP 47 Score = 29.5 bits (63), Expect = 6.0 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1284 PPPPPPPPP 1258 PPPPPPPPP Sbjct: 40 PPPPPPPPP 48 Score = 29.5 bits (63), Expect = 6.0 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1284 PPPPPPPPP 1258 PPPPPPPPP Sbjct: 41 PPPPPPPPP 49 Score = 29.5 bits (63), Expect = 6.0 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1284 PPPPPPPPP 1258 PPPPPPPPP Sbjct: 42 PPPPPPPPP 50 >12_02_0628 + 21357876-21359921 Length = 681 Score = 29.9 bits (64), Expect = 4.5 Identities = 16/49 (32%), Positives = 16/49 (32%) Frame = +2 Query: 1139 GGGGGGGXXXXXXXXXXXXGXXXPPPPPXXXXXXXXXXXXGGGGGGGGG 1285 GGGGG G PP GGG GGGGG Sbjct: 62 GGGGGDGGDSDDSDAAPTLSRKRPPSGSQVPLKKRHQPEKGGGRGGGGG 110 >09_04_0130 - 14905044-14905505,14905865-14905933,14906000-14906104, 14906625-14906690,14907080-14907268,14907353-14907439, 14907597-14908118 Length = 499 Score = 29.9 bits (64), Expect = 4.5 Identities = 16/49 (32%), Positives = 16/49 (32%) Frame = +3 Query: 1140 GGGGGGGXXXXXXXXXXGXXXXPXPPXPXXXXXXXXXXXXGGGGGGGGG 1286 GGG GG P P GGGGGGGGG Sbjct: 175 GGGDAGGVYGGGFAGSLHQQQQHFQPHPQTAPTIPTQSFGGGGGGGGGG 223 >08_02_1258 - 25670092-25670152,25671124-25671327,25671400-25671611, 25671701-25671749,25671833-25672612,25672696-25672767, 25672907-25672954,25673053-25673127,25673238-25673312, 25673614-25673668,25673931-25674016,25674759-25674988 Length = 648 Score = 29.9 bits (64), Expect = 4.5 Identities = 12/26 (46%), Positives = 12/26 (46%) Frame = -2 Query: 1284 PPPPPPPPPXXXXXXXXXXXXGGGGG 1207 PPPPP PPP GGGG Sbjct: 32 PPPPPGPPPQVPHGSKRHRRDEGGGG 57 Score = 29.9 bits (64), Expect = 4.5 Identities = 12/26 (46%), Positives = 12/26 (46%) Frame = -2 Query: 1284 PPPPPPPPPXXXXXXXXXXXXGGGGG 1207 PPPP PPP GGGGG Sbjct: 33 PPPPGPPPQVPHGSKRHRRDEGGGGG 58 >08_01_0003 + 30085-30195,30289-30365,31080-31136,31668-33560, 33643-34147,34250-34358,34436-34548,34619-34806, 35481-36129,36169-36691,36760-36911,37042-37141, 37301-37416 Length = 1530 Score = 29.9 bits (64), Expect = 4.5 Identities = 16/50 (32%), Positives = 16/50 (32%), Gaps = 2/50 (4%) Frame = -3 Query: 1283 PPPPPP--PPXXXXXXXXXXXXXXGGXGXXXPPXXXXXXXXXXPPPPPPP 1140 PPPP P PP PP PPPPPPP Sbjct: 1138 PPPPLPEGPPPLPSDSPPCQPPLPPSPPPATPPPPPPLSPSLPPPPPPPP 1187 >06_03_0447 + 20878444-20878821 Length = 125 Score = 29.9 bits (64), Expect = 4.5 Identities = 15/48 (31%), Positives = 15/48 (31%) Frame = -2 Query: 1284 PPPPPPPPPXXXXXXXXXXXXGGGGGXXXPXXXXXXXXXXXXPPPPPP 1141 PPP PPPPP G G PPPP P Sbjct: 6 PPPSPPPPPLPREAAIAQWRRGRGRVTPSRCLPSRQIDGGKAPPPPRP 53 >05_03_0665 - 16774043-16774522 Length = 159 Score = 29.9 bits (64), Expect = 4.5 Identities = 12/24 (50%), Positives = 12/24 (50%) Frame = +2 Query: 1211 PPPPXXXXXXXXXXXXGGGGGGGG 1282 PPPP GGGGGGGG Sbjct: 84 PPPPGRRDGYLGGGGAGGGGGGGG 107 Score = 29.1 bits (62), Expect = 7.9 Identities = 12/26 (46%), Positives = 12/26 (46%) Frame = +2 Query: 1208 PPPPPXXXXXXXXXXXXGGGGGGGGG 1285 PPPP GGGGGGG G Sbjct: 84 PPPPGRRDGYLGGGGAGGGGGGGGSG 109 >05_01_0004 - 34967-35149,35340-35501,36078-36225,36309-36385, 36507-36577,36850-37263,37518-38268 Length = 601 Score = 29.9 bits (64), Expect = 4.5 Identities = 14/49 (28%), Positives = 14/49 (28%) Frame = -2 Query: 1284 PPPPPPPPPXXXXXXXXXXXXGGGGGXXXPXXXXXXXXXXXXPPPPPPP 1138 PPPPPPPPP P P PPP Sbjct: 77 PPPPPPPPPPRNSPSPPKPPSQAAQSPLPPTTTTTTPPTAPVPAAAPPP 125 >01_01_1130 + 8959909-8960396,8960588-8960638,8960736-8960827, 8960964-8961054,8961877-8961937,8962172-8962216, 8962318-8962391,8962565-8962637,8963288-8963345, 8963398-8963468,8963801-8963837,8964040-8964128, 8964207-8964263,8964366-8964449,8964529-8964627, 8964765-8964869,8965145-8965216,8965308-8965497, 8965810-8966207 Length = 744 Score = 29.9 bits (64), Expect = 4.5 Identities = 17/54 (31%), Positives = 17/54 (31%), Gaps = 6/54 (11%) Frame = -2 Query: 1284 PPPPPPPPPXXXXXXXXXXXXGGGG------GXXXPXXXXXXXXXXXXPPPPPP 1141 PPPPPPPPP GG P PPPP P Sbjct: 82 PPPPPPPPPTNGTLTPPPSSAPSGGRATSSEARESPHATSVDDGGRAPPPPPLP 135 >07_01_0789 - 6150257-6151046,6151167-6151390,6151816-6151991, 6152778-6153801 Length = 737 Score = 24.2 bits (50), Expect(2) = 5.1 Identities = 9/11 (81%), Positives = 9/11 (81%), Gaps = 2/11 (18%) Frame = -2 Query: 1284 PPP--PPPPPP 1258 PPP PPPPPP Sbjct: 99 PPPELPPPPPP 109 Score = 23.8 bits (49), Expect(2) = 5.1 Identities = 7/7 (100%), Positives = 7/7 (100%) Frame = -2 Query: 1158 PPPPPPP 1138 PPPPPPP Sbjct: 105 PPPPPPP 111 >12_02_1119 + 26213719-26213955,26214039-26214197,26214640-26214702, 26214813-26214902,26214984-26215106,26215344-26215431, 26217043-26217117,26218109-26218215 Length = 313 Score = 29.5 bits (63), Expect = 6.0 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1284 PPPPPPPPP 1258 PPPPPPPPP Sbjct: 14 PPPPPPPPP 22 Score = 29.5 bits (63), Expect = 6.0 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1284 PPPPPPPPP 1258 PPPPPPPPP Sbjct: 15 PPPPPPPPP 23 >12_02_1070 - 25814741-25815850 Length = 369 Score = 29.5 bits (63), Expect = 6.0 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1284 PPPPPPPPP 1258 PPPPPPPPP Sbjct: 9 PPPPPPPPP 17 Score = 29.5 bits (63), Expect = 6.0 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1284 PPPPPPPPP 1258 PPPPPPPPP Sbjct: 237 PPPPPPPPP 245 Score = 29.5 bits (63), Expect = 6.0 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1284 PPPPPPPPP 1258 PPPPPPPPP Sbjct: 238 PPPPPPPPP 246 Score = 29.5 bits (63), Expect = 6.0 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1284 PPPPPPPPP 1258 PPPPPPPPP Sbjct: 239 PPPPPPPPP 247 Score = 29.5 bits (63), Expect = 6.0 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1284 PPPPPPPPP 1258 PPPPPPPPP Sbjct: 240 PPPPPPPPP 248 >12_02_0859 - 23751198-23753258 Length = 686 Score = 29.5 bits (63), Expect = 6.0 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1284 PPPPPPPPP 1258 PPPPPPPPP Sbjct: 626 PPPPPPPPP 634 >12_02_0408 + 18659494-18660362,18660472-18660634,18660976-18661139, 18661253-18661511,18661605-18661712 Length = 520 Score = 29.5 bits (63), Expect = 6.0 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1284 PPPPPPPPP 1258 PPPPPPPPP Sbjct: 145 PPPPPPPPP 153 Score = 29.5 bits (63), Expect = 6.0 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1284 PPPPPPPPP 1258 PPPPPPPPP Sbjct: 146 PPPPPPPPP 154 >12_01_0526 - 4171313-4171417,4171514-4171597,4171688-4171758, 4171814-4171891,4174482-4174569,4174659-4174850, 4174939-4175802 Length = 493 Score = 29.5 bits (63), Expect = 6.0 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1284 PPPPPPPPP 1258 PPPPPPPPP Sbjct: 158 PPPPPPPPP 166 >12_01_0495 - 3935395-3937110 Length = 571 Score = 29.5 bits (63), Expect = 6.0 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1284 PPPPPPPPP 1258 PPPPPPPPP Sbjct: 10 PPPPPPPPP 18 Score = 29.5 bits (63), Expect = 6.0 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1284 PPPPPPPPP 1258 PPPPPPPPP Sbjct: 11 PPPPPPPPP 19 >12_01_0442 + 3495333-3496484 Length = 383 Score = 29.5 bits (63), Expect = 6.0 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1284 PPPPPPPPP 1258 PPPPPPPPP Sbjct: 70 PPPPPPPPP 78 >12_01_0373 + 2897874-2898911 Length = 345 Score = 29.5 bits (63), Expect = 6.0 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1284 PPPPPPPPP 1258 PPPPPPPPP Sbjct: 155 PPPPPPPPP 163 Score = 29.5 bits (63), Expect = 6.0 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1284 PPPPPPPPP 1258 PPPPPPPPP Sbjct: 156 PPPPPPPPP 164 >12_01_0319 + 2440129-2440661,2440875-2440902 Length = 186 Score = 29.5 bits (63), Expect = 6.0 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1284 PPPPPPPPP 1258 PPPPPPPPP Sbjct: 46 PPPPPPPPP 54 Score = 29.5 bits (63), Expect = 6.0 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1284 PPPPPPPPP 1258 PPPPPPPPP Sbjct: 47 PPPPPPPPP 55 >11_06_0208 - 21268722-21268763,21269146-21269274,21269388-21269537, 21270402-21270773 Length = 230 Score = 29.5 bits (63), Expect = 6.0 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1284 PPPPPPPPP 1258 PPPPPPPPP Sbjct: 18 PPPPPPPPP 26 Score = 29.5 bits (63), Expect = 6.0 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1284 PPPPPPPPP 1258 PPPPPPPPP Sbjct: 19 PPPPPPPPP 27 >11_06_0081 + 19886848-19888050,19888243-19888896 Length = 618 Score = 29.5 bits (63), Expect = 6.0 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1284 PPPPPPPPP 1258 PPPPPPPPP Sbjct: 262 PPPPPPPPP 270 >11_01_0252 + 1934505-1935032,1936001-1936957 Length = 494 Score = 29.5 bits (63), Expect = 6.0 Identities = 12/26 (46%), Positives = 12/26 (46%) Frame = +2 Query: 1208 PPPPPXXXXXXXXXXXXGGGGGGGGG 1285 PPPPP GG GGGG G Sbjct: 63 PPPPPPPLNWPMAGGGGGGSGGGGRG 88 Score = 29.5 bits (63), Expect = 6.0 Identities = 12/26 (46%), Positives = 12/26 (46%) Frame = +2 Query: 1208 PPPPPXXXXXXXXXXXXGGGGGGGGG 1285 PPPPP G GGGG GG Sbjct: 64 PPPPPPLNWPMAGGGGGGSGGGGRGG 89 >10_08_0527 - 18555231-18555882,18556334-18556463,18557073-18557175 Length = 294 Score = 29.5 bits (63), Expect = 6.0 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1284 PPPPPPPPP 1258 PPPPPPPPP Sbjct: 201 PPPPPPPPP 209 Score = 29.5 bits (63), Expect = 6.0 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1284 PPPPPPPPP 1258 PPPPPPPPP Sbjct: 202 PPPPPPPPP 210 Score = 29.5 bits (63), Expect = 6.0 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1284 PPPPPPPPP 1258 PPPPPPPPP Sbjct: 203 PPPPPPPPP 211 >10_06_0180 + 11526139-11526172,11526365-11527218 Length = 295 Score = 29.5 bits (63), Expect = 6.0 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1284 PPPPPPPPP 1258 PPPPPPPPP Sbjct: 169 PPPPPPPPP 177 >10_06_0152 - 11280532-11281427,11281501-11281971,11282512-11282569 Length = 474 Score = 29.5 bits (63), Expect = 6.0 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1284 PPPPPPPPP 1258 PPPPPPPPP Sbjct: 320 PPPPPPPPP 328 Score = 29.5 bits (63), Expect = 6.0 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1284 PPPPPPPPP 1258 PPPPPPPPP Sbjct: 321 PPPPPPPPP 329 >10_03_0035 - 7265037-7265455,7265684-7265812,7265909-7265951, 7266321-7266344 Length = 204 Score = 29.5 bits (63), Expect = 6.0 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1284 PPPPPPPPP 1258 PPPPPPPPP Sbjct: 120 PPPPPPPPP 128 >10_03_0023 - 7151465-7152111,7152222-7152405 Length = 276 Score = 29.5 bits (63), Expect = 6.0 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1284 PPPPPPPPP 1258 PPPPPPPPP Sbjct: 237 PPPPPPPPP 245 >10_02_0134 + 5667236-5669295,5669833-5669902,5670266-5670376 Length = 746 Score = 29.5 bits (63), Expect = 6.0 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1284 PPPPPPPPP 1258 PPPPPPPPP Sbjct: 6 PPPPPPPPP 14 Score = 29.5 bits (63), Expect = 6.0 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1284 PPPPPPPPP 1258 PPPPPPPPP Sbjct: 7 PPPPPPPPP 15 >10_02_0009 + 4128909-4130123 Length = 404 Score = 29.5 bits (63), Expect = 6.0 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1284 PPPPPPPPP 1258 PPPPPPPPP Sbjct: 84 PPPPPPPPP 92 Score = 29.5 bits (63), Expect = 6.0 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1284 PPPPPPPPP 1258 PPPPPPPPP Sbjct: 85 PPPPPPPPP 93 >09_06_0149 - 21222976-21223065,21223460-21224173 Length = 267 Score = 29.5 bits (63), Expect = 6.0 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1284 PPPPPPPPP 1258 PPPPPPPPP Sbjct: 118 PPPPPPPPP 126 >09_04_0745 + 19884868-19886000,19886110-19886309,19886422-19886666, 19886880-19887668 Length = 788 Score = 29.5 bits (63), Expect = 6.0 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1284 PPPPPPPPP 1258 PPPPPPPPP Sbjct: 264 PPPPPPPPP 272 Score = 29.5 bits (63), Expect = 6.0 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1284 PPPPPPPPP 1258 PPPPPPPPP Sbjct: 265 PPPPPPPPP 273 Score = 29.5 bits (63), Expect = 6.0 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1284 PPPPPPPPP 1258 PPPPPPPPP Sbjct: 266 PPPPPPPPP 274 Score = 29.5 bits (63), Expect = 6.0 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1284 PPPPPPPPP 1258 PPPPPPPPP Sbjct: 267 PPPPPPPPP 275 Score = 29.5 bits (63), Expect = 6.0 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1284 PPPPPPPPP 1258 PPPPPPPPP Sbjct: 268 PPPPPPPPP 276 >09_04_0112 - 14757947-14758972 Length = 341 Score = 29.5 bits (63), Expect = 6.0 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1284 PPPPPPPPP 1258 PPPPPPPPP Sbjct: 295 PPPPPPPPP 303 >09_04_0081 - 14400293-14400397,14400953-14401036,14401144-14401214, 14401293-14401380,14401487-14401678,14401772-14402704 Length = 490 Score = 29.5 bits (63), Expect = 6.0 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1284 PPPPPPPPP 1258 PPPPPPPPP Sbjct: 150 PPPPPPPPP 158 Score = 29.5 bits (63), Expect = 6.0 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1284 PPPPPPPPP 1258 PPPPPPPPP Sbjct: 220 PPPPPPPPP 228 >09_03_0130 - 12609417-12610462,12610786-12611040,12611139-12611253, 12611376-12611428,12611854-12612114,12612252-12612302, 12612412-12612660,12612779-12613007,12613292-12613666 Length = 877 Score = 29.5 bits (63), Expect = 6.0 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1284 PPPPPPPPP 1258 PPPPPPPPP Sbjct: 14 PPPPPPPPP 22 Score = 29.5 bits (63), Expect = 6.0 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1284 PPPPPPPPP 1258 PPPPPPPPP Sbjct: 15 PPPPPPPPP 23 Score = 29.5 bits (63), Expect = 6.0 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1284 PPPPPPPPP 1258 PPPPPPPPP Sbjct: 16 PPPPPPPPP 24 Score = 29.5 bits (63), Expect = 6.0 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1284 PPPPPPPPP 1258 PPPPPPPPP Sbjct: 17 PPPPPPPPP 25 Score = 29.5 bits (63), Expect = 6.0 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1284 PPPPPPPPP 1258 PPPPPPPPP Sbjct: 18 PPPPPPPPP 26 Score = 29.5 bits (63), Expect = 6.0 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1284 PPPPPPPPP 1258 PPPPPPPPP Sbjct: 19 PPPPPPPPP 27 >09_02_0351 - 7686974-7686983,7687142-7687195,7687363-7687408, 7688179-7688280,7688683-7689284,7689599-7689783 Length = 332 Score = 29.5 bits (63), Expect = 6.0 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1284 PPPPPPPPP 1258 PPPPPPPPP Sbjct: 70 PPPPPPPPP 78 >09_01_0037 - 604001-604957 Length = 318 Score = 29.5 bits (63), Expect = 6.0 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1284 PPPPPPPPP 1258 PPPPPPPPP Sbjct: 192 PPPPPPPPP 200 >09_01_0016 - 376742-376883,377973-378964 Length = 377 Score = 29.5 bits (63), Expect = 6.0 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1284 PPPPPPPPP 1258 PPPPPPPPP Sbjct: 60 PPPPPPPPP 68 Score = 29.5 bits (63), Expect = 6.0 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1284 PPPPPPPPP 1258 PPPPPPPPP Sbjct: 61 PPPPPPPPP 69 Score = 29.5 bits (63), Expect = 6.0 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1284 PPPPPPPPP 1258 PPPPPPPPP Sbjct: 62 PPPPPPPPP 70 >08_02_1256 + 25645085-25645396 Length = 103 Score = 29.5 bits (63), Expect = 6.0 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1284 PPPPPPPPP 1258 PPPPPPPPP Sbjct: 61 PPPPPPPPP 69 >08_02_1081 + 24215323-24215335,24215450-24215572,24216241-24216489, 24218517-24218720,24218864-24218993,24219610-24219679, 24219766-24219900,24219996-24220209,24220314-24220455, 24220630-24220851,24220997-24221195 Length = 566 Score = 29.5 bits (63), Expect = 6.0 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1284 PPPPPPPPP 1258 PPPPPPPPP Sbjct: 66 PPPPPPPPP 74 >08_02_0796 - 21300251-21300373,21300846-21301721 Length = 332 Score = 29.5 bits (63), Expect = 6.0 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1284 PPPPPPPPP 1258 PPPPPPPPP Sbjct: 103 PPPPPPPPP 111 Score = 29.5 bits (63), Expect = 6.0 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1284 PPPPPPPPP 1258 PPPPPPPPP Sbjct: 104 PPPPPPPPP 112 Score = 29.5 bits (63), Expect = 6.0 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1284 PPPPPPPPP 1258 PPPPPPPPP Sbjct: 105 PPPPPPPPP 113 Score = 29.5 bits (63), Expect = 6.0 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1284 PPPPPPPPP 1258 PPPPPPPPP Sbjct: 106 PPPPPPPPP 114 Score = 29.5 bits (63), Expect = 6.0 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1284 PPPPPPPPP 1258 PPPPPPPPP Sbjct: 107 PPPPPPPPP 115 Score = 29.5 bits (63), Expect = 6.0 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1284 PPPPPPPPP 1258 PPPPPPPPP Sbjct: 108 PPPPPPPPP 116 >08_01_1081 + 11058119-11059756 Length = 545 Score = 29.5 bits (63), Expect = 6.0 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1284 PPPPPPPPP 1258 PPPPPPPPP Sbjct: 211 PPPPPPPPP 219 >08_01_0493 - 4297761-4298288 Length = 175 Score = 29.5 bits (63), Expect = 6.0 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1284 PPPPPPPPP 1258 PPPPPPPPP Sbjct: 115 PPPPPPPPP 123 >08_01_0420 + 3726392-3727116,3727450-3727648,3727787-3727879, 3728001-3728129,3728445-3728498,3728597-3728674, 3728773-3728835,3729101-3729213,3729392-3729500 Length = 520 Score = 29.5 bits (63), Expect = 6.0 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1284 PPPPPPPPP 1258 PPPPPPPPP Sbjct: 97 PPPPPPPPP 105 >08_01_0204 + 1642169-1642687 Length = 172 Score = 29.5 bits (63), Expect = 6.0 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1284 PPPPPPPPP 1258 PPPPPPPPP Sbjct: 157 PPPPPPPPP 165 >08_01_0193 + 1599970-1600503,1601488-1601919,1602010-1602147, 1602532-1602600 Length = 390 Score = 29.5 bits (63), Expect = 6.0 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1284 PPPPPPPPP 1258 PPPPPPPPP Sbjct: 18 PPPPPPPPP 26 Score = 29.5 bits (63), Expect = 6.0 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1284 PPPPPPPPP 1258 PPPPPPPPP Sbjct: 19 PPPPPPPPP 27 Score = 29.5 bits (63), Expect = 6.0 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1284 PPPPPPPPP 1258 PPPPPPPPP Sbjct: 20 PPPPPPPPP 28 >08_01_0060 - 413088-413999 Length = 303 Score = 29.5 bits (63), Expect = 6.0 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1284 PPPPPPPPP 1258 PPPPPPPPP Sbjct: 29 PPPPPPPPP 37 Score = 29.5 bits (63), Expect = 6.0 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1284 PPPPPPPPP 1258 PPPPPPPPP Sbjct: 30 PPPPPPPPP 38 Score = 29.5 bits (63), Expect = 6.0 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1284 PPPPPPPPP 1258 PPPPPPPPP Sbjct: 31 PPPPPPPPP 39 Score = 29.5 bits (63), Expect = 6.0 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1284 PPPPPPPPP 1258 PPPPPPPPP Sbjct: 32 PPPPPPPPP 40 >07_03_1381 - 26166673-26166747,26166972-26167544 Length = 215 Score = 29.5 bits (63), Expect = 6.0 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1284 PPPPPPPPP 1258 PPPPPPPPP Sbjct: 161 PPPPPPPPP 169 Score = 29.5 bits (63), Expect = 6.0 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1284 PPPPPPPPP 1258 PPPPPPPPP Sbjct: 162 PPPPPPPPP 170 >07_03_1147 + 24349811-24350161,24351031-24351366,24353260-24353376, 24353585-24353647,24354066-24354139,24354216-24354306, 24354791-24354850,24355270-24355462,24356242-24356522, 24357435-24357536,24357664-24357774,24358410-24358475, 24358562-24358660,24358757-24358788,24359171-24359274, 24359380-24359507,24359625-24359756,24360051-24360359, 24360887-24361071,24361161-24361263,24361407-24361552, 24361748-24361827,24361901-24362103 Length = 1121 Score = 29.5 bits (63), Expect = 6.0 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1284 PPPPPPPPP 1258 PPPPPPPPP Sbjct: 63 PPPPPPPPP 71 >07_03_0890 - 22332768-22333382 Length = 204 Score = 29.5 bits (63), Expect = 6.0 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1284 PPPPPPPPP 1258 PPPPPPPPP Sbjct: 84 PPPPPPPPP 92 Score = 29.5 bits (63), Expect = 6.0 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1284 PPPPPPPPP 1258 PPPPPPPPP Sbjct: 85 PPPPPPPPP 93 >07_03_0154 + 14509979-14512033 Length = 684 Score = 29.5 bits (63), Expect = 6.0 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1284 PPPPPPPPP 1258 PPPPPPPPP Sbjct: 53 PPPPPPPPP 61 Score = 29.5 bits (63), Expect = 6.0 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1284 PPPPPPPPP 1258 PPPPPPPPP Sbjct: 54 PPPPPPPPP 62 Score = 29.5 bits (63), Expect = 6.0 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1284 PPPPPPPPP 1258 PPPPPPPPP Sbjct: 55 PPPPPPPPP 63 Score = 29.5 bits (63), Expect = 6.0 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1284 PPPPPPPPP 1258 PPPPPPPPP Sbjct: 56 PPPPPPPPP 64 Score = 29.5 bits (63), Expect = 6.0 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1284 PPPPPPPPP 1258 PPPPPPPPP Sbjct: 57 PPPPPPPPP 65 Score = 29.5 bits (63), Expect = 6.0 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1284 PPPPPPPPP 1258 PPPPPPPPP Sbjct: 58 PPPPPPPPP 66 >07_03_0111 + 13535912-13535972,13536081-13536142,13536418-13536510, 13537577-13537649,13537876-13538265,13538337-13538404, 13539334-13539375,13540211-13540735,13540817-13540974, 13541078-13541636,13542438-13542500,13542579-13542680, 13542779-13543096,13543175-13543267,13543489-13543590, 13543678-13543782,13544190-13544323,13545097-13545280, 13545701-13545832,13546215-13546327,13546468-13546558, 13547138-13549339 Length = 1889 Score = 29.5 bits (63), Expect = 6.0 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1284 PPPPPPPPP 1258 PPPPPPPPP Sbjct: 123 PPPPPPPPP 131 >07_01_0862 - 7172083-7172931 Length = 282 Score = 29.5 bits (63), Expect = 6.0 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1284 PPPPPPPPP 1258 PPPPPPPPP Sbjct: 127 PPPPPPPPP 135 Score = 29.5 bits (63), Expect = 6.0 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1284 PPPPPPPPP 1258 PPPPPPPPP Sbjct: 128 PPPPPPPPP 136 >07_01_0753 - 5799733-5799741,5799938-5800642 Length = 237 Score = 29.5 bits (63), Expect = 6.0 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1284 PPPPPPPPP 1258 PPPPPPPPP Sbjct: 43 PPPPPPPPP 51 Score = 29.5 bits (63), Expect = 6.0 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1284 PPPPPPPPP 1258 PPPPPPPPP Sbjct: 44 PPPPPPPPP 52 Score = 29.5 bits (63), Expect = 6.0 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1284 PPPPPPPPP 1258 PPPPPPPPP Sbjct: 45 PPPPPPPPP 53 Score = 29.5 bits (63), Expect = 6.0 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1284 PPPPPPPPP 1258 PPPPPPPPP Sbjct: 46 PPPPPPPPP 54 >07_01_0321 - 2255342-2255604,2256506-2256779,2256886-2257068 Length = 239 Score = 29.5 bits (63), Expect = 6.0 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1284 PPPPPPPPP 1258 PPPPPPPPP Sbjct: 37 PPPPPPPPP 45 >07_01_0080 + 587674-588510 Length = 278 Score = 29.5 bits (63), Expect = 6.0 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1284 PPPPPPPPP 1258 PPPPPPPPP Sbjct: 91 PPPPPPPPP 99 Score = 29.5 bits (63), Expect = 6.0 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1284 PPPPPPPPP 1258 PPPPPPPPP Sbjct: 104 PPPPPPPPP 112 Score = 29.5 bits (63), Expect = 6.0 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1284 PPPPPPPPP 1258 PPPPPPPPP Sbjct: 105 PPPPPPPPP 113 Score = 29.5 bits (63), Expect = 6.0 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1284 PPPPPPPPP 1258 PPPPPPPPP Sbjct: 106 PPPPPPPPP 114 Score = 29.5 bits (63), Expect = 6.0 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1284 PPPPPPPPP 1258 PPPPPPPPP Sbjct: 107 PPPPPPPPP 115 Score = 29.5 bits (63), Expect = 6.0 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1284 PPPPPPPPP 1258 PPPPPPPPP Sbjct: 108 PPPPPPPPP 116 Score = 29.5 bits (63), Expect = 6.0 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1284 PPPPPPPPP 1258 PPPPPPPPP Sbjct: 109 PPPPPPPPP 117 Score = 29.5 bits (63), Expect = 6.0 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1284 PPPPPPPPP 1258 PPPPPPPPP Sbjct: 110 PPPPPPPPP 118 Score = 29.5 bits (63), Expect = 6.0 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1284 PPPPPPPPP 1258 PPPPPPPPP Sbjct: 111 PPPPPPPPP 119 Score = 29.5 bits (63), Expect = 6.0 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1284 PPPPPPPPP 1258 PPPPPPPPP Sbjct: 112 PPPPPPPPP 120 Score = 29.5 bits (63), Expect = 6.0 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1284 PPPPPPPPP 1258 PPPPPPPPP Sbjct: 113 PPPPPPPPP 121 >06_03_1191 + 28286685-28287008,28287149-28287211,28287377-28287461, 28287561-28287623,28287954-28288029,28288190-28288223, 28289553-28289659,28289738-28289807,28289852-28289950 Length = 306 Score = 29.5 bits (63), Expect = 6.0 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1284 PPPPPPPPP 1258 PPPPPPPPP Sbjct: 19 PPPPPPPPP 27 >06_03_0750 - 24140988-24141037,24141108-24141345,24142158-24142232, 24142345-24142413,24142550-24142581,24143503-24143583, 24143791-24143851,24144135-24144275,24144372-24144563 Length = 312 Score = 29.5 bits (63), Expect = 6.0 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1284 PPPPPPPPP 1258 PPPPPPPPP Sbjct: 43 PPPPPPPPP 51 >06_03_0743 + 24069752-24070483,24071890-24072345 Length = 395 Score = 29.5 bits (63), Expect = 6.0 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1284 PPPPPPPPP 1258 PPPPPPPPP Sbjct: 25 PPPPPPPPP 33 Score = 29.5 bits (63), Expect = 6.0 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1284 PPPPPPPPP 1258 PPPPPPPPP Sbjct: 26 PPPPPPPPP 34 >06_03_0696 + 23617687-23617851,23618838-23619536 Length = 287 Score = 29.5 bits (63), Expect = 6.0 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1284 PPPPPPPPP 1258 PPPPPPPPP Sbjct: 77 PPPPPPPPP 85 Score = 29.5 bits (63), Expect = 6.0 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1284 PPPPPPPPP 1258 PPPPPPPPP Sbjct: 78 PPPPPPPPP 86 Score = 29.5 bits (63), Expect = 6.0 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1284 PPPPPPPPP 1258 PPPPPPPPP Sbjct: 79 PPPPPPPPP 87 >06_03_0526 + 21771519-21771607,21771685-21771810,21771890-21772010, 21772123-21772851,21772954-21773349,21774594-21774665, 21774741-21774803,21775236-21775337 Length = 565 Score = 29.5 bits (63), Expect = 6.0 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1284 PPPPPPPPP 1258 PPPPPPPPP Sbjct: 310 PPPPPPPPP 318 Score = 29.5 bits (63), Expect = 6.0 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1284 PPPPPPPPP 1258 PPPPPPPPP Sbjct: 311 PPPPPPPPP 319 >06_02_0257 - 13533689-13533714,13533799-13533925,13534013-13534121, 13534193-13534272,13534758-13534979,13536070-13536318, 13537032-13537484,13539834-13540556 Length = 662 Score = 29.5 bits (63), Expect = 6.0 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1284 PPPPPPPPP 1258 PPPPPPPPP Sbjct: 63 PPPPPPPPP 71 >06_02_0024 - 10714741-10716241,10716774-10717840 Length = 855 Score = 29.5 bits (63), Expect = 6.0 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1284 PPPPPPPPP 1258 PPPPPPPPP Sbjct: 2 PPPPPPPPP 10 >06_01_0921 + 7104923-7105396,7106624-7106768,7107078-7107121 Length = 220 Score = 29.5 bits (63), Expect = 6.0 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1284 PPPPPPPPP 1258 PPPPPPPPP Sbjct: 55 PPPPPPPPP 63 >06_01_0561 - 3983308-3983564,3983652-3983775 Length = 126 Score = 29.5 bits (63), Expect = 6.0 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1284 PPPPPPPPP 1258 PPPPPPPPP Sbjct: 31 PPPPPPPPP 39 Score = 29.5 bits (63), Expect = 6.0 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1284 PPPPPPPPP 1258 PPPPPPPPP Sbjct: 32 PPPPPPPPP 40 >05_07_0332 - 29332520-29332818,29333511-29333725,29334380-29334408, 29334956-29335045,29335120-29335155,29335222-29336553, 29337331-29337497,29337519-29337724,29337815-29338036, 29338332-29338381,29338754-29338870,29339471-29339551, 29339656-29339694,29340464-29340636,29340769-29340826, 29340934-29340987,29341066-29341613,29341695-29341755, 29342180-29342260,29342448-29342630,29342908-29343162, 29343304-29343423,29343497-29344901,29344988-29345085, 29345164-29345218,29345307-29345366,29346498-29346697 Length = 2077 Score = 29.5 bits (63), Expect = 6.0 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1284 PPPPPPPPP 1258 PPPPPPPPP Sbjct: 1931 PPPPPPPPP 1939 >05_06_0051 - 25190803-25191216,25191301-25191891,25193248-25193317, 25193392-25193443,25195368-25195440,25195557-25195646 Length = 429 Score = 29.5 bits (63), Expect = 6.0 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1284 PPPPPPPPP 1258 PPPPPPPPP Sbjct: 100 PPPPPPPPP 108 >05_05_0207 + 23272777-23272977,23273831-23275330 Length = 566 Score = 29.5 bits (63), Expect = 6.0 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1284 PPPPPPPPP 1258 PPPPPPPPP Sbjct: 53 PPPPPPPPP 61 >05_05_0181 + 23033059-23033775 Length = 238 Score = 29.5 bits (63), Expect = 6.0 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1284 PPPPPPPPP 1258 PPPPPPPPP Sbjct: 166 PPPPPPPPP 174 >05_04_0173 + 18724367-18724476,18724570-18724651,18724750-18724840, 18725060-18725172,18725270-18725342,18725445-18725565, 18725665-18725782,18726609-18726748,18726824-18726881, 18727007-18727077,18727181-18727733 Length = 509 Score = 29.5 bits (63), Expect = 6.0 Identities = 18/49 (36%), Positives = 18/49 (36%) Frame = +2 Query: 1139 GGGGGGGXXXXXXXXXXXXGXXXPPPPPXXXXXXXXXXXXGGGGGGGGG 1285 GG GGGG G PPP P G GGG GGG Sbjct: 426 GGQGGGGSYGNAPYPQQGRGP--PPPYPGSGMAGTGGPRGGVGGGYGGG 472 >05_04_0160 - 18624952-18625106,18625411-18625535,18625954-18626087, 18626221-18626298,18626456-18626561,18627739-18627836 Length = 231 Score = 29.5 bits (63), Expect = 6.0 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1284 PPPPPPPPP 1258 PPPPPPPPP Sbjct: 12 PPPPPPPPP 20 >05_01_0210 + 1583176-1584177 Length = 333 Score = 29.5 bits (63), Expect = 6.0 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1284 PPPPPPPPP 1258 PPPPPPPPP Sbjct: 32 PPPPPPPPP 40 Score = 29.5 bits (63), Expect = 6.0 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1284 PPPPPPPPP 1258 PPPPPPPPP Sbjct: 33 PPPPPPPPP 41 >05_01_0192 + 1394342-1396645 Length = 767 Score = 29.5 bits (63), Expect = 6.0 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1284 PPPPPPPPP 1258 PPPPPPPPP Sbjct: 3 PPPPPPPPP 11 Score = 29.5 bits (63), Expect = 6.0 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1284 PPPPPPPPP 1258 PPPPPPPPP Sbjct: 4 PPPPPPPPP 12 >04_04_1687 - 35365766-35366356,35367137-35368135 Length = 529 Score = 29.5 bits (63), Expect = 6.0 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1284 PPPPPPPPP 1258 PPPPPPPPP Sbjct: 10 PPPPPPPPP 18 Score = 29.5 bits (63), Expect = 6.0 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1284 PPPPPPPPP 1258 PPPPPPPPP Sbjct: 11 PPPPPPPPP 19 Score = 29.5 bits (63), Expect = 6.0 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1284 PPPPPPPPP 1258 PPPPPPPPP Sbjct: 12 PPPPPPPPP 20 Score = 29.5 bits (63), Expect = 6.0 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1284 PPPPPPPPP 1258 PPPPPPPPP Sbjct: 13 PPPPPPPPP 21 Score = 29.5 bits (63), Expect = 6.0 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1284 PPPPPPPPP 1258 PPPPPPPPP Sbjct: 14 PPPPPPPPP 22 Score = 29.5 bits (63), Expect = 6.0 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1284 PPPPPPPPP 1258 PPPPPPPPP Sbjct: 15 PPPPPPPPP 23 >04_04_0887 + 29095087-29096166 Length = 359 Score = 29.5 bits (63), Expect = 6.0 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1284 PPPPPPPPP 1258 PPPPPPPPP Sbjct: 132 PPPPPPPPP 140 Score = 29.5 bits (63), Expect = 6.0 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1284 PPPPPPPPP 1258 PPPPPPPPP Sbjct: 133 PPPPPPPPP 141 >04_04_0708 - 27441373-27442611 Length = 412 Score = 29.5 bits (63), Expect = 6.0 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1284 PPPPPPPPP 1258 PPPPPPPPP Sbjct: 241 PPPPPPPPP 249 Score = 29.5 bits (63), Expect = 6.0 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1284 PPPPPPPPP 1258 PPPPPPPPP Sbjct: 242 PPPPPPPPP 250 Score = 29.5 bits (63), Expect = 6.0 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1284 PPPPPPPPP 1258 PPPPPPPPP Sbjct: 243 PPPPPPPPP 251 >04_04_0198 + 23502657-23502900,23505228-23505298,23505690-23505727, 23505905-23507693 Length = 713 Score = 29.5 bits (63), Expect = 6.0 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1284 PPPPPPPPP 1258 PPPPPPPPP Sbjct: 549 PPPPPPPPP 557 Score = 29.5 bits (63), Expect = 6.0 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1284 PPPPPPPPP 1258 PPPPPPPPP Sbjct: 550 PPPPPPPPP 558 Score = 29.5 bits (63), Expect = 6.0 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1284 PPPPPPPPP 1258 PPPPPPPPP Sbjct: 551 PPPPPPPPP 559 Score = 29.5 bits (63), Expect = 6.0 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1284 PPPPPPPPP 1258 PPPPPPPPP Sbjct: 552 PPPPPPPPP 560 >04_04_0057 + 22410167-22411330 Length = 387 Score = 29.5 bits (63), Expect = 6.0 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1284 PPPPPPPPP 1258 PPPPPPPPP Sbjct: 181 PPPPPPPPP 189 >04_03_0977 + 21381857-21383757,21384299-21384458,21384669-21384717, 21385117-21385169 Length = 720 Score = 29.5 bits (63), Expect = 6.0 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1284 PPPPPPPPP 1258 PPPPPPPPP Sbjct: 101 PPPPPPPPP 109 Score = 29.5 bits (63), Expect = 6.0 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1284 PPPPPPPPP 1258 PPPPPPPPP Sbjct: 102 PPPPPPPPP 110 >04_03_0212 + 12697854-12698549,12698655-12698930,12698991-12699038, 12699659-12699715,12700965-12701163,12702267-12702373, 12702586-12702759,12702844-12703083,12703638-12703693, 12704499-12704622 Length = 658 Score = 29.5 bits (63), Expect = 6.0 Identities = 12/24 (50%), Positives = 12/24 (50%) Frame = +2 Query: 1214 PPPXXXXXXXXXXXXGGGGGGGGG 1285 PPP GGGGGGGGG Sbjct: 43 PPPLAISSPGCDGGGGGGGGGGGG 66 >04_01_0354 - 4646826-4647314 Length = 162 Score = 29.5 bits (63), Expect = 6.0 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1284 PPPPPPPPP 1258 PPPPPPPPP Sbjct: 93 PPPPPPPPP 101 Score = 29.5 bits (63), Expect = 6.0 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1284 PPPPPPPPP 1258 PPPPPPPPP Sbjct: 94 PPPPPPPPP 102 Score = 29.5 bits (63), Expect = 6.0 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1284 PPPPPPPPP 1258 PPPPPPPPP Sbjct: 95 PPPPPPPPP 103 Score = 29.5 bits (63), Expect = 6.0 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1284 PPPPPPPPP 1258 PPPPPPPPP Sbjct: 96 PPPPPPPPP 104 >04_01_0246 + 3225743-3226473,3226493-3226624,3227580-3227670, 3228617-3229074,3229342-3229864 Length = 644 Score = 29.5 bits (63), Expect = 6.0 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1284 PPPPPPPPP 1258 PPPPPPPPP Sbjct: 37 PPPPPPPPP 45 >03_06_0771 - 36152554-36153215,36153320-36153818,36153924-36153956 Length = 397 Score = 29.5 bits (63), Expect = 6.0 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1284 PPPPPPPPP 1258 PPPPPPPPP Sbjct: 355 PPPPPPPPP 363 Score = 29.5 bits (63), Expect = 6.0 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1284 PPPPPPPPP 1258 PPPPPPPPP Sbjct: 356 PPPPPPPPP 364 Score = 29.5 bits (63), Expect = 6.0 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1284 PPPPPPPPP 1258 PPPPPPPPP Sbjct: 357 PPPPPPPPP 365 Score = 29.5 bits (63), Expect = 6.0 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1284 PPPPPPPPP 1258 PPPPPPPPP Sbjct: 358 PPPPPPPPP 366 >03_06_0600 + 34988743-34989407,34990033-34990051 Length = 227 Score = 29.5 bits (63), Expect = 6.0 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1284 PPPPPPPPP 1258 PPPPPPPPP Sbjct: 152 PPPPPPPPP 160 >03_06_0599 + 34984869-34985319,34986581-34987563 Length = 477 Score = 29.5 bits (63), Expect = 6.0 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1284 PPPPPPPPP 1258 PPPPPPPPP Sbjct: 404 PPPPPPPPP 412 >03_06_0411 + 33741903-33742163,33742990-33743168,33743342-33743426, 33743506-33743822,33743983-33744106,33744810-33744902, 33745296-33745364,33745654-33745704,33745705-33745854, 33745904-33746125,33746413-33746568,33746716-33746823, 33746992-33747126,33747209-33747364,33747544-33747664, 33748182-33748267 Length = 770 Score = 29.5 bits (63), Expect = 6.0 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1284 PPPPPPPPP 1258 PPPPPPPPP Sbjct: 416 PPPPPPPPP 424 Score = 29.5 bits (63), Expect = 6.0 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1284 PPPPPPPPP 1258 PPPPPPPPP Sbjct: 417 PPPPPPPPP 425 >03_05_1096 - 30364144-30365310,30365825-30365971,30366087-30366393, 30366541-30366849,30367544-30370567,30370640-30372290, 30372373-30373463,30373544-30373646,30373737-30374439, 30374654-30375783,30375913-30376027,30376504-30376695, 30377443-30377616,30378438-30378494,30378581-30378716, 30378842-30378927,30379023-30379092,30379993-30380021, 30380444-30380456,30380762-30381006 Length = 3582 Score = 29.5 bits (63), Expect = 6.0 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1284 PPPPPPPPP 1258 PPPPPPPPP Sbjct: 21 PPPPPPPPP 29 >03_05_0918 - 28785233-28786613,28786894-28787140,28787773-28788238 Length = 697 Score = 29.5 bits (63), Expect = 6.0 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1284 PPPPPPPPP 1258 PPPPPPPPP Sbjct: 16 PPPPPPPPP 24 Score = 29.5 bits (63), Expect = 6.0 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1284 PPPPPPPPP 1258 PPPPPPPPP Sbjct: 17 PPPPPPPPP 25 Score = 29.5 bits (63), Expect = 6.0 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1284 PPPPPPPPP 1258 PPPPPPPPP Sbjct: 18 PPPPPPPPP 26 >03_05_0732 - 27232299-27232535,27232717-27232746,27233094-27233155, 27233975-27234005,27234618-27234713,27234881-27234969, 27235687-27236263 Length = 373 Score = 29.5 bits (63), Expect = 6.0 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1284 PPPPPPPPP 1258 PPPPPPPPP Sbjct: 54 PPPPPPPPP 62 >03_02_0784 - 11154395-11154888,11155284-11155360,11155447-11155497, 11155599-11155672,11156127-11156215,11156533-11156618, 11157570-11157669,11158540-11158622,11158776-11159194 Length = 490 Score = 29.5 bits (63), Expect = 6.0 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1284 PPPPPPPPP 1258 PPPPPPPPP Sbjct: 428 PPPPPPPPP 436 Score = 29.5 bits (63), Expect = 6.0 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1284 PPPPPPPPP 1258 PPPPPPPPP Sbjct: 429 PPPPPPPPP 437 Score = 29.5 bits (63), Expect = 6.0 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1284 PPPPPPPPP 1258 PPPPPPPPP Sbjct: 430 PPPPPPPPP 438 Score = 29.5 bits (63), Expect = 6.0 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1284 PPPPPPPPP 1258 PPPPPPPPP Sbjct: 431 PPPPPPPPP 439 >03_02_0455 - 8630543-8630893,8630994-8631068,8631149-8631223, 8631332-8631397,8631891-8631967,8632659-8633070 Length = 351 Score = 29.5 bits (63), Expect = 6.0 Identities = 16/48 (33%), Positives = 16/48 (33%) Frame = -3 Query: 1283 PPPPPPPPXXXXXXXXXXXXXXGGXGXXXPPXXXXXXXXXXPPPPPPP 1140 PPPP PP G PP PPPPPPP Sbjct: 267 PPPPQVPPPPPQAPPPPPPNAPMGMPPRIPPPPVGGTQ---PPPPPPP 311 >03_01_0219 + 1731267-1731728,1732148-1732235,1732330-1732417, 1732528-1732573,1732687-1732785,1734363-1734431, 1735706-1736036,1736123-1736256,1736400-1737251 Length = 722 Score = 29.5 bits (63), Expect = 6.0 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1284 PPPPPPPPP 1258 PPPPPPPPP Sbjct: 11 PPPPPPPPP 19 >02_05_0925 - 32768815-32769654 Length = 279 Score = 29.5 bits (63), Expect = 6.0 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1284 PPPPPPPPP 1258 PPPPPPPPP Sbjct: 156 PPPPPPPPP 164 Score = 29.5 bits (63), Expect = 6.0 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1284 PPPPPPPPP 1258 PPPPPPPPP Sbjct: 157 PPPPPPPPP 165 >02_05_0543 + 29872168-29872767,29873089-29873115 Length = 208 Score = 29.5 bits (63), Expect = 6.0 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1284 PPPPPPPPP 1258 PPPPPPPPP Sbjct: 182 PPPPPPPPP 190 Score = 29.5 bits (63), Expect = 6.0 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1284 PPPPPPPPP 1258 PPPPPPPPP Sbjct: 183 PPPPPPPPP 191 >02_04_0520 - 23628183-23628195,23629354-23630036 Length = 231 Score = 29.5 bits (63), Expect = 6.0 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1284 PPPPPPPPP 1258 PPPPPPPPP Sbjct: 193 PPPPPPPPP 201 >02_04_0312 - 21942310-21943356 Length = 348 Score = 29.5 bits (63), Expect = 6.0 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1284 PPPPPPPPP 1258 PPPPPPPPP Sbjct: 178 PPPPPPPPP 186 >02_02_0489 + 10869482-10871218 Length = 578 Score = 29.5 bits (63), Expect = 6.0 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1284 PPPPPPPPP 1258 PPPPPPPPP Sbjct: 10 PPPPPPPPP 18 >02_02_0359 - 9390175-9390416,9390924-9391044,9391069-9391410, 9392400-9392759 Length = 354 Score = 29.5 bits (63), Expect = 6.0 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1284 PPPPPPPPP 1258 PPPPPPPPP Sbjct: 37 PPPPPPPPP 45 Score = 29.5 bits (63), Expect = 6.0 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1284 PPPPPPPPP 1258 PPPPPPPPP Sbjct: 38 PPPPPPPPP 46 Score = 29.5 bits (63), Expect = 6.0 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1284 PPPPPPPPP 1258 PPPPPPPPP Sbjct: 39 PPPPPPPPP 47 >02_01_0458 + 3291563-3291733,3292082-3292769,3292847-3293363, 3293438-3293637,3294137-3294372,3294469-3295302 Length = 881 Score = 29.5 bits (63), Expect = 6.0 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1284 PPPPPPPPP 1258 PPPPPPPPP Sbjct: 353 PPPPPPPPP 361 Score = 29.5 bits (63), Expect = 6.0 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1284 PPPPPPPPP 1258 PPPPPPPPP Sbjct: 354 PPPPPPPPP 362 Score = 29.5 bits (63), Expect = 6.0 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1284 PPPPPPPPP 1258 PPPPPPPPP Sbjct: 355 PPPPPPPPP 363 Score = 29.5 bits (63), Expect = 6.0 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1284 PPPPPPPPP 1258 PPPPPPPPP Sbjct: 356 PPPPPPPPP 364 Score = 29.5 bits (63), Expect = 6.0 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1284 PPPPPPPPP 1258 PPPPPPPPP Sbjct: 357 PPPPPPPPP 365 Score = 29.5 bits (63), Expect = 6.0 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1284 PPPPPPPPP 1258 PPPPPPPPP Sbjct: 358 PPPPPPPPP 366 Score = 29.5 bits (63), Expect = 6.0 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1284 PPPPPPPPP 1258 PPPPPPPPP Sbjct: 359 PPPPPPPPP 367 Score = 29.5 bits (63), Expect = 6.0 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1284 PPPPPPPPP 1258 PPPPPPPPP Sbjct: 360 PPPPPPPPP 368 Score = 29.5 bits (63), Expect = 6.0 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1284 PPPPPPPPP 1258 PPPPPPPPP Sbjct: 361 PPPPPPPPP 369 Score = 29.5 bits (63), Expect = 6.0 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1284 PPPPPPPPP 1258 PPPPPPPPP Sbjct: 362 PPPPPPPPP 370 Score = 29.5 bits (63), Expect = 6.0 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1284 PPPPPPPPP 1258 PPPPPPPPP Sbjct: 363 PPPPPPPPP 371 >02_01_0377 + 2728892-2729187,2729483-2729544,2730516-2730570, 2730784-2730858,2730980-2731054,2731155-2731202, 2731548-2732357,2732450-2732498,2733157-2733266, 2733381-2733488,2733920-2733980 Length = 582 Score = 29.5 bits (63), Expect = 6.0 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1284 PPPPPPPPP 1258 PPPPPPPPP Sbjct: 12 PPPPPPPPP 20 Score = 29.5 bits (63), Expect = 6.0 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1284 PPPPPPPPP 1258 PPPPPPPPP Sbjct: 13 PPPPPPPPP 21 >02_01_0016 + 110796-110979,111252-111768,111847-112213 Length = 355 Score = 29.5 bits (63), Expect = 6.0 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1284 PPPPPPPPP 1258 PPPPPPPPP Sbjct: 216 PPPPPPPPP 224 >01_06_1805 - 39999987-40000169,40000648-40000974,40001724-40002017, 40002112-40002231,40002714-40002776,40003150-40003310, 40003864-40004035 Length = 439 Score = 29.5 bits (63), Expect = 6.0 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1284 PPPPPPPPP 1258 PPPPPPPPP Sbjct: 27 PPPPPPPPP 35 >01_06_1612 - 38635703-38636215,38638725-38638967 Length = 251 Score = 29.5 bits (63), Expect = 6.0 Identities = 12/26 (46%), Positives = 12/26 (46%) Frame = +2 Query: 1208 PPPPPXXXXXXXXXXXXGGGGGGGGG 1285 PPPPP GGGGG G G Sbjct: 114 PPPPPTQLMVPVVGYGGGGGGGAGEG 139 >01_06_0883 + 32708037-32708558,32708627-32708911,32709661-32709675 Length = 273 Score = 29.5 bits (63), Expect = 6.0 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1284 PPPPPPPPP 1258 PPPPPPPPP Sbjct: 38 PPPPPPPPP 46 Score = 29.5 bits (63), Expect = 6.0 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1284 PPPPPPPPP 1258 PPPPPPPPP Sbjct: 39 PPPPPPPPP 47 >01_06_0357 - 28668894-28669238,28669510-28669537,28669578-28669635, 28669836-28669916,28670395-28670526,28670609-28670926, 28672495-28673317 Length = 594 Score = 29.5 bits (63), Expect = 6.0 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1284 PPPPPPPPP 1258 PPPPPPPPP Sbjct: 2 PPPPPPPPP 10 Score = 29.5 bits (63), Expect = 6.0 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1284 PPPPPPPPP 1258 PPPPPPPPP Sbjct: 3 PPPPPPPPP 11 Score = 29.5 bits (63), Expect = 6.0 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1284 PPPPPPPPP 1258 PPPPPPPPP Sbjct: 4 PPPPPPPPP 12 Score = 29.5 bits (63), Expect = 6.0 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1284 PPPPPPPPP 1258 PPPPPPPPP Sbjct: 5 PPPPPPPPP 13 >01_06_0090 + 26358051-26359157,26359582-26359701,26359968-26360099, 26360194-26360375,26360488-26360602,26362001-26362135, 26362261-26362395 Length = 641 Score = 29.5 bits (63), Expect = 6.0 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1284 PPPPPPPPP 1258 PPPPPPPPP Sbjct: 290 PPPPPPPPP 298 >01_05_0501 + 22764978-22765896,22766087-22766349,22766613-22766836, 22767419-22767749,22767968-22768372 Length = 713 Score = 29.5 bits (63), Expect = 6.0 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1284 PPPPPPPPP 1258 PPPPPPPPP Sbjct: 76 PPPPPPPPP 84 Score = 29.5 bits (63), Expect = 6.0 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1284 PPPPPPPPP 1258 PPPPPPPPP Sbjct: 77 PPPPPPPPP 85 Score = 29.5 bits (63), Expect = 6.0 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1284 PPPPPPPPP 1258 PPPPPPPPP Sbjct: 78 PPPPPPPPP 86 Score = 29.5 bits (63), Expect = 6.0 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1284 PPPPPPPPP 1258 PPPPPPPPP Sbjct: 79 PPPPPPPPP 87 Score = 29.5 bits (63), Expect = 6.0 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1284 PPPPPPPPP 1258 PPPPPPPPP Sbjct: 80 PPPPPPPPP 88 >01_05_0423 + 22032940-22033695 Length = 251 Score = 29.5 bits (63), Expect = 6.0 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1284 PPPPPPPPP 1258 PPPPPPPPP Sbjct: 28 PPPPPPPPP 36 >01_03_0076 - 12241408-12241545,12241719-12241790,12242173-12242289, 12243307-12245127,12245361-12245810 Length = 865 Score = 29.5 bits (63), Expect = 6.0 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1284 PPPPPPPPP 1258 PPPPPPPPP Sbjct: 130 PPPPPPPPP 138 >01_01_1162 - 9253034-9254229,9254387-9254456,9254473-9254567, 9255344-9255487,9255514-9255622 Length = 537 Score = 29.5 bits (63), Expect = 6.0 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1284 PPPPPPPPP 1258 PPPPPPPPP Sbjct: 205 PPPPPPPPP 213 >01_01_1001 - 7925858-7926559 Length = 233 Score = 29.5 bits (63), Expect = 6.0 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1284 PPPPPPPPP 1258 PPPPPPPPP Sbjct: 27 PPPPPPPPP 35 >01_01_0889 + 7008077-7009261 Length = 394 Score = 29.5 bits (63), Expect = 6.0 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1284 PPPPPPPPP 1258 PPPPPPPPP Sbjct: 278 PPPPPPPPP 286 >01_01_0761 - 5874953-5876803 Length = 616 Score = 29.5 bits (63), Expect = 6.0 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1284 PPPPPPPPP 1258 PPPPPPPPP Sbjct: 45 PPPPPPPPP 53 >01_01_0369 - 2886060-2886272,2886721-2887434 Length = 308 Score = 29.5 bits (63), Expect = 6.0 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1284 PPPPPPPPP 1258 PPPPPPPPP Sbjct: 129 PPPPPPPPP 137 >01_01_0046 - 331758-332627 Length = 289 Score = 29.5 bits (63), Expect = 6.0 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1284 PPPPPPPPP 1258 PPPPPPPPP Sbjct: 21 PPPPPPPPP 29 Score = 29.5 bits (63), Expect = 6.0 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1284 PPPPPPPPP 1258 PPPPPPPPP Sbjct: 22 PPPPPPPPP 30 Score = 29.5 bits (63), Expect = 6.0 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1284 PPPPPPPPP 1258 PPPPPPPPP Sbjct: 23 PPPPPPPPP 31 Score = 29.5 bits (63), Expect = 6.0 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1284 PPPPPPPPP 1258 PPPPPPPPP Sbjct: 24 PPPPPPPPP 32 >05_01_0131 + 888247-888771,889092-889154 Length = 195 Score = 23.8 bits (49), Expect(2) = 7.5 Identities = 7/7 (100%), Positives = 7/7 (100%) Frame = -3 Query: 1283 PPPPPPP 1263 PPPPPPP Sbjct: 133 PPPPPPP 139 Score = 23.8 bits (49), Expect(2) = 7.5 Identities = 7/7 (100%), Positives = 7/7 (100%) Frame = -3 Query: 1280 PPPPPPP 1260 PPPPPPP Sbjct: 133 PPPPPPP 139 Score = 23.8 bits (49), Expect(2) = 7.5 Identities = 7/7 (100%), Positives = 7/7 (100%) Frame = -3 Query: 1280 PPPPPPP 1260 PPPPPPP Sbjct: 160 PPPPPPP 166 Score = 23.8 bits (49), Expect(2) = 7.5 Identities = 7/7 (100%), Positives = 7/7 (100%) Frame = -3 Query: 1160 PPPPPPP 1140 PPPPPPP Sbjct: 160 PPPPPPP 166 >12_01_0477 + 3742751-3745200,3747192-3747502,3747886-3748232 Length = 1035 Score = 29.1 bits (62), Expect = 7.9 Identities = 13/32 (40%), Positives = 13/32 (40%) Frame = +3 Query: 1191 GXXXXPXPPXPXXXXXXXXXXXXGGGGGGGGG 1286 G P P P GGGGGGGGG Sbjct: 38 GPRSDPATPIPVSPRVSVMRRGGGGGGGGGGG 69 >10_08_0222 - 15983756-15984313 Length = 185 Score = 29.1 bits (62), Expect = 7.9 Identities = 16/49 (32%), Positives = 16/49 (32%) Frame = +3 Query: 1140 GGGGGGGXXXXXXXXXXGXXXXPXPPXPXXXXXXXXXXXXGGGGGGGGG 1286 GGGGGGG G GGGGGG GG Sbjct: 31 GGGGGGGGGGGSSGGGSGWGSGSGSGYGQAGGSGGAYASGGGGGGGSGG 79 >09_01_0112 + 1737438-1737777,1738441-1738511,1738974-1739052, 1741559-1741641,1741733-1741784,1742038-1742105, 1742279-1742345,1742426-1742505,1742576-1742640, 1742785-1742847,1743271-1743427,1743511-1743588, 1743677-1744219,1744321-1744497,1744534-1744788, 1745270-1745329,1745874-1745888,1746123-1746135, 1746819-1746934 Length = 793 Score = 29.1 bits (62), Expect = 7.9 Identities = 16/48 (33%), Positives = 16/48 (33%) Frame = +1 Query: 1141 GGGGGGGXXXXXXXXXXGGXXXPXPPXXXXXXXXXXXXXXGGGGGGGG 1284 GG G G GG PP GGGGGGGG Sbjct: 22 GGDGRFGRGPSRWSSGGGGGGSGSPPHRFSRGGGGGGGDGGGGGGGGG 69 >07_03_1524 + 27442435-27442627,27442928-27443323,27443815-27444116 Length = 296 Score = 29.1 bits (62), Expect = 7.9 Identities = 13/32 (40%), Positives = 13/32 (40%) Frame = +3 Query: 1191 GXXXXPXPPXPXXXXXXXXXXXXGGGGGGGGG 1286 G P P P GGGGGGGGG Sbjct: 211 GSKDPPAPTLPPPLTVGTTAVGSGGGGGGGGG 242 >07_03_0560 + 19479597-19480667 Length = 356 Score = 29.1 bits (62), Expect = 7.9 Identities = 16/47 (34%), Positives = 16/47 (34%) Frame = +1 Query: 1141 GGGGGGGXXXXXXXXXXGGXXXPXPPXXXXXXXXXXXXXXGGGGGGG 1281 GGGGGGG GG GGGGGGG Sbjct: 243 GGGGGGGMGGGGGGGMGGGAGGGFGGGAGGGAGQGGSGGLGGGGGGG 289 >04_04_1149 + 31273203-31273695,31274016-31275165,31275617-31277078 Length = 1034 Score = 29.1 bits (62), Expect = 7.9 Identities = 16/48 (33%), Positives = 16/48 (33%) Frame = +1 Query: 1141 GGGGGGGXXXXXXXXXXGGXXXPXPPXXXXXXXXXXXXXXGGGGGGGG 1284 GG G GG GG PP G GGGGGG Sbjct: 24 GGDGRGGGYGGAGGGGVGGRGGRGPPGGGGGRGYEPGGGRGYGGGGGG 71 >03_05_0269 - 22545925-22546554,22546663-22547010,22547447-22547797 Length = 442 Score = 29.1 bits (62), Expect = 7.9 Identities = 18/49 (36%), Positives = 18/49 (36%) Frame = +2 Query: 1139 GGGGGGGXXXXXXXXXXXXGXXXPPPPPXXXXXXXXXXXXGGGGGGGGG 1285 GGGGGGG P P GGGGGGGGG Sbjct: 5 GGGGGGGEMLAPLMEG--------PDPESGDGEGGGGGGGGGGGGGGGG 45 >03_03_0038 + 13984525-13984917,13985351-13985429,13985535-13985628, 13985712-13985844 Length = 232 Score = 29.1 bits (62), Expect = 7.9 Identities = 14/49 (28%), Positives = 14/49 (28%) Frame = -2 Query: 1284 PPPPPPPPPXXXXXXXXXXXXGGGGGXXXPXXXXXXXXXXXXPPPPPPP 1138 PPPPPPP PPPPPPP Sbjct: 38 PPPPPPPQLRGGETKKKKKPDARTAAEAAQGLQRHEVERRKKPPPPPPP 86 >01_06_0823 + 32234588-32234936,32236354-32237093,32237260-32237343, 32237909-32239263,32240399-32240460,32240544-32241144, 32241229-32241310,32241778-32241840 Length = 1111 Score = 29.1 bits (62), Expect = 7.9 Identities = 17/50 (34%), Positives = 17/50 (34%), Gaps = 2/50 (4%) Frame = -3 Query: 1283 PPPPPPPPXXXXXXXXXXXXXXGGXGXXXPPXXXXXXXXXXPPPP--PPP 1140 PPPPPPPP PP PPPP PPP Sbjct: 964 PPPPPPPPNVAPPPFTRQDIP---PPPPSPPPLPITQPPSVPPPPNSPPP 1010 >01_03_0005 + 11568545-11569119,11569179-11569191 Length = 195 Score = 29.1 bits (62), Expect = 7.9 Identities = 14/29 (48%), Positives = 14/29 (48%), Gaps = 3/29 (10%) Frame = +2 Query: 1208 PPPP---PXXXXXXXXXXXXGGGGGGGGG 1285 PPPP P GGGGGGGGG Sbjct: 58 PPPPVVTPTPQCPPPPSYPSGGGGGGGGG 86 >01_01_0446 + 3321832-3322232,3322398-3322455,3322810-3323748, 3324504-3324654,3324740-3324818,3325826-3325934 Length = 578 Score = 29.1 bits (62), Expect = 7.9 Identities = 16/49 (32%), Positives = 16/49 (32%) Frame = +3 Query: 1140 GGGGGGGXXXXXXXXXXGXXXXPXPPXPXXXXXXXXXXXXGGGGGGGGG 1286 G GG G G P P GGGGGGGGG Sbjct: 366 GAPGGQGSLPPSYDGGYGGRPMPGGGGPGAPPPYHGGGGGGGGGGGGGG 414 >03_06_0399 - 33632811-33633107,33633236-33633385,33633705-33634029, 33635315-33635982,33636967-33637212,33637405-33637545, 33637807-33637856,33637943-33638060,33638304-33638910, 33639339-33639463,33639813-33639869,33639952-33640023, 33640100-33640232,33640305-33640428,33640522-33640576, 33640672-33641322 Length = 1272 Score = 26.2 bits (55), Expect(2) = 8.2 Identities = 8/9 (88%), Positives = 8/9 (88%) Frame = -2 Query: 1284 PPPPPPPPP 1258 PPPP PPPP Sbjct: 46 PPPPSPPPP 54 Score = 21.0 bits (42), Expect(2) = 8.2 Identities = 6/6 (100%), Positives = 6/6 (100%) Frame = -2 Query: 1155 PPPPPP 1138 PPPPPP Sbjct: 74 PPPPPP 79 >01_05_0552 - 23173106-23173184,23173266-23173411,23173543-23174022, 23174106-23174161,23175538-23175637,23175708-23175765, 23176163-23176278,23176915-23176974,23177297-23177383, 23178250-23178341,23178409-23178587,23178946-23179087, 23179655-23179706,23180241-23180473,23180569-23180745, 23180882-23181044,23181242-23181392,23181493-23181574, 23182193-23182332,23182499-23183013 Length = 1035 Score = 25.8 bits (54), Expect(2) = 8.3 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = +2 Query: 1259 GGGGGGGGG 1285 GGGGGGGGG Sbjct: 107 GGGGGGGGG 115 Score = 25.8 bits (54), Expect(2) = 8.3 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = +2 Query: 1259 GGGGGGGGG 1285 GGGGGGGGG Sbjct: 108 GGGGGGGGG 116 Score = 21.4 bits (43), Expect(2) = 8.3 Identities = 8/13 (61%), Positives = 8/13 (61%) Frame = +2 Query: 1121 FXXXXXGGGGGGG 1159 F GGGGGGG Sbjct: 99 FGEFLRGGGGGGG 111 Score = 21.4 bits (43), Expect(2) = 8.3 Identities = 8/14 (57%), Positives = 8/14 (57%) Frame = +2 Query: 1118 FFXXXXXGGGGGGG 1159 F GGGGGGG Sbjct: 102 FLRGGGGGGGGGGG 115 >06_03_1178 + 28203466-28204590,28204745-28205652,28206189-28206258 Length = 700 Score = 26.6 bits (56), Expect(2) = 8.6 Identities = 8/8 (100%), Positives = 8/8 (100%) Frame = -3 Query: 1283 PPPPPPPP 1260 PPPPPPPP Sbjct: 241 PPPPPPPP 248 Score = 20.6 bits (41), Expect(2) = 8.6 Identities = 6/7 (85%), Positives = 6/7 (85%) Frame = -3 Query: 1160 PPPPPPP 1140 PPPPP P Sbjct: 244 PPPPPTP 250 >10_08_0925 + 21604871-21605021,21605562-21605881,21606899-21607897, 21608085-21608126,21608190-21608249,21608915-21608959 Length = 538 Score = 25.8 bits (54), Expect(2) = 8.8 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = +2 Query: 1259 GGGGGGGGG 1285 GGGGGGGGG Sbjct: 11 GGGGGGGGG 19 Score = 21.4 bits (43), Expect(2) = 8.8 Identities = 8/13 (61%), Positives = 8/13 (61%) Frame = +2 Query: 1121 FXXXXXGGGGGGG 1159 F GGGGGGG Sbjct: 6 FVESGGGGGGGGG 18 >03_06_0264 + 32738224-32738553,32739298-32739768,32739864-32740007, 32740570-32740671,32741758-32741873,32741959-32742028, 32742308-32742376,32742898-32742948,32743038-32743196 Length = 503 Score = 25.8 bits (54), Expect(2) = 8.9 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = +2 Query: 1259 GGGGGGGGG 1285 GGGGGGGGG Sbjct: 81 GGGGGGGGG 89 Score = 21.4 bits (43), Expect(2) = 8.9 Identities = 8/13 (61%), Positives = 8/13 (61%) Frame = +2 Query: 1121 FXXXXXGGGGGGG 1159 F GGGGGGG Sbjct: 74 FSIDGGGGGGGGG 86 >11_05_0093 + 18992027-18993514 Length = 495 Score = 26.6 bits (56), Expect(2) = 8.9 Identities = 8/8 (100%), Positives = 8/8 (100%) Frame = -3 Query: 1283 PPPPPPPP 1260 PPPPPPPP Sbjct: 374 PPPPPPPP 381 Score = 20.6 bits (41), Expect(2) = 8.9 Identities = 6/7 (85%), Positives = 6/7 (85%) Frame = -3 Query: 1160 PPPPPPP 1140 PPPPP P Sbjct: 377 PPPPPTP 383 >01_06_1737 - 39559321-39559461,39559761-39559817,39559919-39560117, 39560217-39560344,39560443-39560548,39560721-39560800, 39561189-39561286,39561368-39561481,39561567-39561707, 39561801-39561885,39562761-39563099 Length = 495 Score = 25.8 bits (54), Expect(2) = 8.9 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = +2 Query: 1259 GGGGGGGGG 1285 GGGGGGGGG Sbjct: 31 GGGGGGGGG 39 Score = 21.4 bits (43), Expect(2) = 8.9 Identities = 8/13 (61%), Positives = 8/13 (61%) Frame = +2 Query: 1121 FXXXXXGGGGGGG 1159 F GGGGGGG Sbjct: 24 FQQQWGGGGGGGG 36 >02_01_0158 - 1103461-1104186 Length = 241 Score = 25.8 bits (54), Expect(2) = 9.5 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = +2 Query: 1259 GGGGGGGGG 1285 GGGGGGGGG Sbjct: 83 GGGGGGGGG 91 Score = 21.4 bits (43), Expect(2) = 9.5 Identities = 8/13 (61%), Positives = 8/13 (61%) Frame = +2 Query: 1121 FXXXXXGGGGGGG 1159 F GGGGGGG Sbjct: 77 FVKGGAGGGGGGG 89 >02_01_0400 - 2922837-2923060,2923280-2923367,2923422-2923473, 2924133-2924206,2924298-2924395,2924650-2924719 Length = 201 Score = 25.8 bits (54), Expect(2) = 9.7 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = +2 Query: 1259 GGGGGGGGG 1285 GGGGGGGGG Sbjct: 150 GGGGGGGGG 158 Score = 21.4 bits (43), Expect(2) = 9.7 Identities = 8/13 (61%), Positives = 8/13 (61%) Frame = +2 Query: 1121 FXXXXXGGGGGGG 1159 F GGGGGGG Sbjct: 142 FPPFRFGGGGGGG 154 >02_01_0471 - 3364215-3364912,3365511-3365742,3365827-3366198, 3366324-3366449,3367056-3367262,3367399-3367492, 3367575-3367621,3367705-3368157,3368261-3368560, 3368656-3369114,3369189-3369410,3369659-3369890, 3370051-3370422,3371210-3371322,3371682-3371903, 3371977-3372180,3372308-3372572,3373123-3373311, 3373441-3373768,3373843-3374248,3374339-3374648, 3375677-3375837,3376825-3376998,3377265-3377609, 3377713-3377754,3378585-3378734,3378847-3379002, 3379088-3379540,3379651-3379966,3380402-3380839, 3381475-3381697,3383538-3383852,3384033-3384095, 3384699-3384903,3385362-3385425,3386014-3386204 Length = 3048 Score = 25.8 bits (54), Expect(2) = 9.8 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = +3 Query: 1260 GGGGGGGGG 1286 GGGGGGGGG Sbjct: 24 GGGGGGGGG 32 Score = 21.0 bits (42), Expect(2) = 9.8 Identities = 7/7 (100%), Positives = 7/7 (100%) Frame = +3 Query: 1140 GGGGGGG 1160 GGGGGGG Sbjct: 22 GGGGGGG 28 >10_08_0241 - 16111792-16112367 Length = 191 Score = 25.8 bits (54), Expect(2) = 9.8 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = +2 Query: 1259 GGGGGGGGG 1285 GGGGGGGGG Sbjct: 70 GGGGGGGGG 78 Score = 21.4 bits (43), Expect(2) = 9.8 Identities = 7/14 (50%), Positives = 9/14 (64%) Frame = +2 Query: 1118 FFXXXXXGGGGGGG 1159 ++ GGGGGGG Sbjct: 63 YYGAHASGGGGGGG 76 >10_08_0240 - 16106963-16107538 Length = 191 Score = 25.8 bits (54), Expect(2) = 9.8 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = +2 Query: 1259 GGGGGGGGG 1285 GGGGGGGGG Sbjct: 70 GGGGGGGGG 78 Score = 21.4 bits (43), Expect(2) = 9.8 Identities = 7/14 (50%), Positives = 9/14 (64%) Frame = +2 Query: 1118 FFXXXXXGGGGGGG 1159 ++ GGGGGGG Sbjct: 63 YYGAHASGGGGGGG 76 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 32,768,921 Number of Sequences: 37544 Number of extensions: 1078060 Number of successful extensions: 83961 Number of sequences better than 10.0: 226 Number of HSP's better than 10.0 without gapping: 3344 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 35837 length of database: 14,793,348 effective HSP length: 84 effective length of database: 11,639,652 effective search space used: 4004040288 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -