BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= FWDP01_FL5_P12 (1288 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_33909| Best HMM Match : FH2 (HMM E-Value=0) 42 0.001 SB_12366| Best HMM Match : SRCR (HMM E-Value=4.4e-33) 38 0.013 SB_40518| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.053 SB_34481| Best HMM Match : Extensin_2 (HMM E-Value=0.48) 36 0.093 SB_16095| Best HMM Match : Podocalyxin (HMM E-Value=1) 35 0.12 SB_55393| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 0.17 SB_2559| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 0.17 SB_48634| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 0.17 SB_43066| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 0.23 SB_56047| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.28 SB_19987| Best HMM Match : MFMR (HMM E-Value=1.4) 33 0.49 SB_43690| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.65 SB_37803| Best HMM Match : WH2 (HMM E-Value=1.8e-10) 32 0.86 SB_2012| Best HMM Match : Extensin_2 (HMM E-Value=0.1) 32 1.1 SB_58757| Best HMM Match : GRP (HMM E-Value=0.0041) 31 2.0 SB_52222| Best HMM Match : SAPS (HMM E-Value=2.1e-37) 31 2.6 SB_39784| Best HMM Match : WH2 (HMM E-Value=2e-05) 30 3.5 SB_18024| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 3.5 SB_10535| Best HMM Match : Extensin_2 (HMM E-Value=0.013) 30 3.5 SB_53582| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 3.5 SB_21376| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 3.5 SB_55818| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 4.6 SB_11023| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 4.6 SB_44752| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 5.5 SB_47784| Best HMM Match : Ank (HMM E-Value=1.4e-08) 29 6.1 SB_47508| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.1 SB_47282| Best HMM Match : RCSD (HMM E-Value=0.53) 29 6.1 SB_42034| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.1 SB_29861| Best HMM Match : RRM_1 (HMM E-Value=1.10002e-42) 29 6.1 SB_21275| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.1 SB_20622| Best HMM Match : zf-CHC2 (HMM E-Value=0.64) 29 6.1 SB_19504| Best HMM Match : FH2 (HMM E-Value=1.2e-30) 29 6.1 SB_11994| Best HMM Match : ERM (HMM E-Value=0.28) 29 6.1 SB_11868| Best HMM Match : zf-CHC2 (HMM E-Value=0.64) 29 6.1 SB_9896| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.1 SB_52556| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.1 SB_44647| Best HMM Match : C_tripleX (HMM E-Value=0.00011) 29 6.1 SB_44156| Best HMM Match : Extensin_2 (HMM E-Value=0.05) 29 6.1 SB_42380| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.1 SB_38456| Best HMM Match : BTB (HMM E-Value=8.8e-26) 29 6.1 SB_18739| Best HMM Match : YhhN (HMM E-Value=7.3) 29 6.1 SB_11420| Best HMM Match : MBOAT (HMM E-Value=6.9e-06) 29 6.1 SB_5350| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.1 SB_35885| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 8.0 SB_18993| Best HMM Match : DEAD (HMM E-Value=9.3e-41) 24 8.8 >SB_33909| Best HMM Match : FH2 (HMM E-Value=0) Length = 1063 Score = 41.5 bits (93), Expect = 0.001 Identities = 18/47 (38%), Positives = 18/47 (38%) Frame = -3 Query: 1283 PPPPPPPPXXXXXXXXXXXXXXGGXGXXXPPXXXXXXXXXXPPPPPP 1143 PPPPPPPP G G PP PPPPPP Sbjct: 713 PPPPPPPPGCAGLPPPPPSPQPGCAGLPPPPPPPPPGCAGLPPPPPP 759 Score = 38.3 bits (85), Expect = 0.013 Identities = 17/48 (35%), Positives = 17/48 (35%) Frame = -3 Query: 1283 PPPPPPPPXXXXXXXXXXXXXXGGXGXXXPPXXXXXXXXXXPPPPPPP 1140 PPPPPPPP G PP PPPPPP Sbjct: 712 PPPPPPPPPGCAGLPPPPPSPQPGCAGLPPPPPPPPPGCAGLPPPPPP 759 Score = 36.3 bits (80), Expect = 0.053 Identities = 19/54 (35%), Positives = 19/54 (35%), Gaps = 5/54 (9%) Frame = -2 Query: 1284 PPPPPPPPP-----XXXXXXXXXXXXGGGGGXXXPXXXXXXXXXXXXPPPPPPP 1138 PPPPPPPPP G G P PPPPPPP Sbjct: 694 PPPPPPPPPPLLSGTLPMPPPPPPPPPGCAGLPPPPPSPQPGCAGLPPPPPPPP 747 Score = 35.5 bits (78), Expect = 0.093 Identities = 19/54 (35%), Positives = 19/54 (35%), Gaps = 5/54 (9%) Frame = -2 Query: 1284 PPPPPPPPPXXXXXXXXXXXX-----GGGGGXXXPXXXXXXXXXXXXPPPPPPP 1138 PPPPPPPPP G G P PPPPPPP Sbjct: 695 PPPPPPPPPLLSGTLPMPPPPPPPPPGCAGLPPPPPSPQPGCAGLPPPPPPPPP 748 Score = 33.1 bits (72), Expect = 0.49 Identities = 19/53 (35%), Positives = 19/53 (35%), Gaps = 5/53 (9%) Frame = -3 Query: 1283 PPPPPPPPXXXXXXXXXXXXXX---GGXGXXXPPXXXXXXXXXXPPPP--PPP 1140 PPPPPPPP G G PP PPPP PPP Sbjct: 696 PPPPPPPPLLSGTLPMPPPPPPPPPGCAGLPPPPPSPQPGCAGLPPPPPPPPP 748 Score = 30.3 bits (65), Expect = 3.5 Identities = 16/48 (33%), Positives = 16/48 (33%) Frame = -3 Query: 1283 PPPPPPPPXXXXXXXXXXXXXXGGXGXXXPPXXXXXXXXXXPPPPPPP 1140 PPPPPP P PP PPPPPPP Sbjct: 677 PPPPPPLPVIEGSSLSVPPPPP----PPPPPLLSGTLPMPPPPPPPPP 720 >SB_12366| Best HMM Match : SRCR (HMM E-Value=4.4e-33) Length = 457 Score = 38.3 bits (85), Expect = 0.013 Identities = 17/48 (35%), Positives = 17/48 (35%) Frame = -3 Query: 1283 PPPPPPPPXXXXXXXXXXXXXXGGXGXXXPPXXXXXXXXXXPPPPPPP 1140 PPPPPPPP PP PPPPPPP Sbjct: 367 PPPPPPPPPPSPPPPPPPPPPSPPPPPQPPPPPPPPPPPPPPPPPPPP 414 Score = 38.3 bits (85), Expect = 0.013 Identities = 17/48 (35%), Positives = 17/48 (35%) Frame = -3 Query: 1283 PPPPPPPPXXXXXXXXXXXXXXGGXGXXXPPXXXXXXXXXXPPPPPPP 1140 PPPPPPPP PP PPPPPPP Sbjct: 368 PPPPPPPPPSPPPPPPPPPPSPPPPPQPPPPPPPPPPPPPPPPPPPPP 415 Score = 38.3 bits (85), Expect = 0.013 Identities = 17/48 (35%), Positives = 17/48 (35%) Frame = -3 Query: 1283 PPPPPPPPXXXXXXXXXXXXXXGGXGXXXPPXXXXXXXXXXPPPPPPP 1140 PPPPPPPP PP PPPPPPP Sbjct: 369 PPPPPPPPSPPPPPPPPPPSPPPPPQPPPPPPPPPPPPPPPPPPPPPP 416 Score = 38.3 bits (85), Expect = 0.013 Identities = 17/48 (35%), Positives = 17/48 (35%) Frame = -3 Query: 1283 PPPPPPPPXXXXXXXXXXXXXXGGXGXXXPPXXXXXXXXXXPPPPPPP 1140 PPPPPPPP PP PPPPPPP Sbjct: 379 PPPPPPPPPSPPPPPQPPPPPPPPPPPPPPPPPPPPPPPPAPPPPPPP 426 Score = 38.3 bits (85), Expect = 0.013 Identities = 17/48 (35%), Positives = 17/48 (35%) Frame = -3 Query: 1283 PPPPPPPPXXXXXXXXXXXXXXGGXGXXXPPXXXXXXXXXXPPPPPPP 1140 PPPPPPPP PP PPPPPPP Sbjct: 380 PPPPPPPPSPPPPPQPPPPPPPPPPPPPPPPPPPPPPPPAPPPPPPPP 427 Score = 37.1 bits (82), Expect = 0.030 Identities = 17/49 (34%), Positives = 17/49 (34%) Frame = -2 Query: 1284 PPPPPPPPPXXXXXXXXXXXXGGGGGXXXPXXXXXXXXXXXXPPPPPPP 1138 PPPPPPPPP P PPPPPPP Sbjct: 378 PPPPPPPPPPSPPPPPQPPPPPPPPPPPPPPPPPPPPPPPPAPPPPPPP 426 Score = 35.1 bits (77), Expect = 0.12 Identities = 16/48 (33%), Positives = 16/48 (33%) Frame = -3 Query: 1283 PPPPPPPPXXXXXXXXXXXXXXGGXGXXXPPXXXXXXXXXXPPPPPPP 1140 PPPPPPP PP PPPPPPP Sbjct: 370 PPPPPPPSPPPPPPPPPPSPPPPPQPPPPPPPPPPPPPPPPPPPPPPP 417 Score = 35.1 bits (77), Expect = 0.12 Identities = 16/48 (33%), Positives = 16/48 (33%) Frame = -3 Query: 1283 PPPPPPPPXXXXXXXXXXXXXXGGXGXXXPPXXXXXXXXXXPPPPPPP 1140 PPPPPP P PP PPPPPPP Sbjct: 371 PPPPPPSPPPPPPPPPPSPPPPPQPPPPPPPPPPPPPPPPPPPPPPPP 418 Score = 35.1 bits (77), Expect = 0.12 Identities = 16/48 (33%), Positives = 16/48 (33%) Frame = -3 Query: 1283 PPPPPPPPXXXXXXXXXXXXXXGGXGXXXPPXXXXXXXXXXPPPPPPP 1140 PPPPPPP PP PPPPPPP Sbjct: 381 PPPPPPPSPPPPPQPPPPPPPPPPPPPPPPPPPPPPPPAPPPPPPPPP 428 Score = 35.1 bits (77), Expect = 0.12 Identities = 16/48 (33%), Positives = 16/48 (33%) Frame = -3 Query: 1283 PPPPPPPPXXXXXXXXXXXXXXGGXGXXXPPXXXXXXXXXXPPPPPPP 1140 PPPPPP P PP PPPPPPP Sbjct: 382 PPPPPPSPPPPPQPPPPPPPPPPPPPPPPPPPPPPPPAPPPPPPPPPP 429 Score = 35.1 bits (77), Expect = 0.12 Identities = 16/48 (33%), Positives = 16/48 (33%) Frame = -3 Query: 1283 PPPPPPPPXXXXXXXXXXXXXXGGXGXXXPPXXXXXXXXXXPPPPPPP 1140 PPPPP PP PP PPPPPPP Sbjct: 383 PPPPPSPPPPPQPPPPPPPPPPPPPPPPPPPPPPPPAPPPPPPPPPPP 430 Score = 35.1 bits (77), Expect = 0.12 Identities = 16/48 (33%), Positives = 16/48 (33%) Frame = -3 Query: 1283 PPPPPPPPXXXXXXXXXXXXXXGGXGXXXPPXXXXXXXXXXPPPPPPP 1140 PPPP PPP PP PPPPPPP Sbjct: 384 PPPPSPPPPPQPPPPPPPPPPPPPPPPPPPPPPPPAPPPPPPPPPPPP 431 Score = 35.1 bits (77), Expect = 0.12 Identities = 16/48 (33%), Positives = 16/48 (33%) Frame = -3 Query: 1283 PPPPPPPPXXXXXXXXXXXXXXGGXGXXXPPXXXXXXXXXXPPPPPPP 1140 PPP PPPP PP PPPPPPP Sbjct: 385 PPPSPPPPPQPPPPPPPPPPPPPPPPPPPPPPPPAPPPPPPPPPPPPP 432 Score = 34.7 bits (76), Expect = 0.16 Identities = 16/49 (32%), Positives = 16/49 (32%) Frame = -2 Query: 1284 PPPPPPPPPXXXXXXXXXXXXGGGGGXXXPXXXXXXXXXXXXPPPPPPP 1138 PPPPPPPPP PPPPPPP Sbjct: 365 PPPPPPPPPPPPSPPPPPPPPPPSPPPPPQPPPPPPPPPPPPPPPPPPP 413 Score = 29.5 bits (63), Expect = 6.1 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1284 PPPPPPPPP 1258 PPPPPPPPP Sbjct: 420 PPPPPPPPP 428 Score = 29.5 bits (63), Expect = 6.1 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1284 PPPPPPPPP 1258 PPPPPPPPP Sbjct: 421 PPPPPPPPP 429 Score = 29.5 bits (63), Expect = 6.1 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1284 PPPPPPPPP 1258 PPPPPPPPP Sbjct: 422 PPPPPPPPP 430 Score = 29.5 bits (63), Expect = 6.1 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1284 PPPPPPPPP 1258 PPPPPPPPP Sbjct: 423 PPPPPPPPP 431 Score = 29.5 bits (63), Expect = 6.1 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1284 PPPPPPPPP 1258 PPPPPPPPP Sbjct: 424 PPPPPPPPP 432 >SB_40518| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1000 Score = 36.3 bits (80), Expect = 0.053 Identities = 18/47 (38%), Positives = 18/47 (38%) Frame = -2 Query: 1278 PPPPPPPXXXXXXXXXXXXGGGGGXXXPXXXXXXXXXXXXPPPPPPP 1138 PPPPPPP GGG P PPPPPPP Sbjct: 953 PPPPPPPGGSAPPP-----GGGAPPLPPPPGGSAPPPPPPPPPPPPP 994 Score = 35.9 bits (79), Expect = 0.070 Identities = 18/47 (38%), Positives = 18/47 (38%) Frame = -3 Query: 1280 PPPPPPPXXXXXXXXXXXXXXGGXGXXXPPXXXXXXXXXXPPPPPPP 1140 PPPPPPP GG PP PPPPPPP Sbjct: 953 PPPPPPPGGSAPPPG------GGAPPLPPPPGGSAPPPPPPPPPPPP 993 Score = 31.9 bits (69), Expect = 1.1 Identities = 18/48 (37%), Positives = 18/48 (37%) Frame = -3 Query: 1283 PPPPPPPPXXXXXXXXXXXXXXGGXGXXXPPXXXXXXXXXXPPPPPPP 1140 PPPPPPP GG PP PPPPPPP Sbjct: 920 PPPPPPP----GGNAPLPPPPPGGSAPSQPP----PPGGNAPPPPPPP 959 Score = 30.7 bits (66), Expect = 2.6 Identities = 16/46 (34%), Positives = 16/46 (34%) Frame = -2 Query: 1275 PPPPPPXXXXXXXXXXXXGGGGGXXXPXXXXXXXXXXXXPPPPPPP 1138 PPPPPP GG P PPPPPPP Sbjct: 920 PPPPPPPGGNAPLPPPPPGGSAPSQPP------PPGGNAPPPPPPP 959 Score = 29.5 bits (63), Expect = 6.1 Identities = 17/55 (30%), Positives = 17/55 (30%), Gaps = 6/55 (10%) Frame = -2 Query: 1284 PPPPP------PPPPXXXXXXXXXXXXGGGGGXXXPXXXXXXXXXXXXPPPPPPP 1138 PPPPP PPPP GG P PP PPP Sbjct: 922 PPPPPGGNAPLPPPPPGGSAPSQPPPPGGNAPPPPPPPGGSAPPPGGGAPPLPPP 976 Score = 29.5 bits (63), Expect = 6.1 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1284 PPPPPPPPP 1258 PPPPPPPPP Sbjct: 982 PPPPPPPPP 990 Score = 29.5 bits (63), Expect = 6.1 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1284 PPPPPPPPP 1258 PPPPPPPPP Sbjct: 983 PPPPPPPPP 991 Score = 29.5 bits (63), Expect = 6.1 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1284 PPPPPPPPP 1258 PPPPPPPPP Sbjct: 984 PPPPPPPPP 992 Score = 29.5 bits (63), Expect = 6.1 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1284 PPPPPPPPP 1258 PPPPPPPPP Sbjct: 985 PPPPPPPPP 993 Score = 29.5 bits (63), Expect = 6.1 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1284 PPPPPPPPP 1258 PPPPPPPPP Sbjct: 986 PPPPPPPPP 994 >SB_34481| Best HMM Match : Extensin_2 (HMM E-Value=0.48) Length = 341 Score = 35.5 bits (78), Expect = 0.093 Identities = 16/48 (33%), Positives = 16/48 (33%) Frame = -3 Query: 1283 PPPPPPPPXXXXXXXXXXXXXXGGXGXXXPPXXXXXXXXXXPPPPPPP 1140 P PPPPP G PP PPPPPPP Sbjct: 290 PVPPPPPADGSAPAPPPPPPPGGAPPPPPPPPPPPPGDGGAPPPPPPP 337 Score = 34.7 bits (76), Expect = 0.16 Identities = 16/48 (33%), Positives = 16/48 (33%) Frame = -2 Query: 1281 PPPPPPPPXXXXXXXXXXXXGGGGGXXXPXXXXXXXXXXXXPPPPPPP 1138 P PPPPP GG P PPPPPPP Sbjct: 290 PVPPPPPADGSAPAPPPPPPPGGAPPPPPPPPPPPPGDGGAPPPPPPP 337 Score = 30.3 bits (65), Expect = 3.5 Identities = 13/37 (35%), Positives = 13/37 (35%) Frame = +3 Query: 843 GGGGXXPPPXXXXXXXXXXXXXXXXXXXKXPPPPPPP 953 GGG PPP PPPPPPP Sbjct: 286 GGGAPVPPPPPADGSAPAPPPPPPPGGAPPPPPPPPP 322 >SB_16095| Best HMM Match : Podocalyxin (HMM E-Value=1) Length = 768 Score = 35.1 bits (77), Expect = 0.12 Identities = 16/46 (34%), Positives = 16/46 (34%) Frame = -3 Query: 1283 PPPPPPPPXXXXXXXXXXXXXXGGXGXXXPPXXXXXXXXXXPPPPP 1146 PPPPPPPP G PP PPPPP Sbjct: 660 PPPPPPPPPGGQAGGAPPPPPPPLPGGAAPPPPPPIGGGAPPPPPP 705 >SB_55393| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1597 Score = 29.5 bits (63), Expect = 6.1 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1284 PPPPPPPPP 1258 PPPPPPPPP Sbjct: 683 PPPPPPPPP 691 Score = 29.5 bits (63), Expect(2) = 0.17 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1284 PPPPPPPPP 1258 PPPPPPPPP Sbjct: 684 PPPPPPPPP 692 Score = 29.5 bits (63), Expect = 6.1 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1284 PPPPPPPPP 1258 PPPPPPPPP Sbjct: 685 PPPPPPPPP 693 Score = 29.5 bits (63), Expect = 6.1 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1284 PPPPPPPPP 1258 PPPPPPPPP Sbjct: 686 PPPPPPPPP 694 Score = 29.5 bits (63), Expect = 6.1 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1284 PPPPPPPPP 1258 PPPPPPPPP Sbjct: 687 PPPPPPPPP 695 Score = 29.5 bits (63), Expect(2) = 1.3 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1284 PPPPPPPPP 1258 PPPPPPPPP Sbjct: 688 PPPPPPPPP 696 Score = 29.5 bits (63), Expect = 6.1 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1284 PPPPPPPPP 1258 PPPPPPPPP Sbjct: 689 PPPPPPPPP 697 Score = 29.5 bits (63), Expect = 6.1 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1284 PPPPPPPPP 1258 PPPPPPPPP Sbjct: 690 PPPPPPPPP 698 Score = 29.5 bits (63), Expect = 6.1 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1284 PPPPPPPPP 1258 PPPPPPPPP Sbjct: 691 PPPPPPPPP 699 Score = 29.5 bits (63), Expect = 6.1 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1284 PPPPPPPPP 1258 PPPPPPPPP Sbjct: 692 PPPPPPPPP 700 Score = 29.5 bits (63), Expect = 6.1 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1284 PPPPPPPPP 1258 PPPPPPPPP Sbjct: 693 PPPPPPPPP 701 Score = 23.8 bits (49), Expect(2) = 0.17 Identities = 7/7 (100%), Positives = 7/7 (100%) Frame = -2 Query: 1158 PPPPPPP 1138 PPPPPPP Sbjct: 689 PPPPPPP 695 Score = 20.6 bits (41), Expect(2) = 1.3 Identities = 6/7 (85%), Positives = 6/7 (85%) Frame = -2 Query: 1158 PPPPPPP 1138 PPPPP P Sbjct: 697 PPPPPQP 703 >SB_2559| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1324 Score = 29.5 bits (63), Expect(2) = 0.17 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1284 PPPPPPPPP 1258 PPPPPPPPP Sbjct: 1157 PPPPPPPPP 1165 Score = 29.5 bits (63), Expect = 6.1 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1284 PPPPPPPPP 1258 PPPPPPPPP Sbjct: 1158 PPPPPPPPP 1166 Score = 29.5 bits (63), Expect = 6.1 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1284 PPPPPPPPP 1258 PPPPPPPPP Sbjct: 1159 PPPPPPPPP 1167 Score = 29.5 bits (63), Expect = 6.1 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1284 PPPPPPPPP 1258 PPPPPPPPP Sbjct: 1160 PPPPPPPPP 1168 Score = 29.5 bits (63), Expect = 6.1 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1284 PPPPPPPPP 1258 PPPPPPPPP Sbjct: 1173 PPPPPPPPP 1181 Score = 29.5 bits (63), Expect = 6.1 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1284 PPPPPPPPP 1258 PPPPPPPPP Sbjct: 1174 PPPPPPPPP 1182 Score = 29.5 bits (63), Expect = 6.1 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1284 PPPPPPPPP 1258 PPPPPPPPP Sbjct: 1175 PPPPPPPPP 1183 Score = 29.5 bits (63), Expect = 6.1 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1284 PPPPPPPPP 1258 PPPPPPPPP Sbjct: 1176 PPPPPPPPP 1184 Score = 23.8 bits (49), Expect(2) = 0.17 Identities = 7/7 (100%), Positives = 7/7 (100%) Frame = -2 Query: 1158 PPPPPPP 1138 PPPPPPP Sbjct: 1177 PPPPPPP 1183 >SB_48634| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1066 Score = 29.5 bits (63), Expect = 6.1 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1284 PPPPPPPPP 1258 PPPPPPPPP Sbjct: 867 PPPPPPPPP 875 Score = 29.5 bits (63), Expect(2) = 0.17 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1284 PPPPPPPPP 1258 PPPPPPPPP Sbjct: 868 PPPPPPPPP 876 Score = 29.5 bits (63), Expect(2) = 0.17 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1284 PPPPPPPPP 1258 PPPPPPPPP Sbjct: 869 PPPPPPPPP 877 Score = 29.5 bits (63), Expect = 6.1 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1284 PPPPPPPPP 1258 PPPPPPPPP Sbjct: 870 PPPPPPPPP 878 Score = 29.5 bits (63), Expect = 6.1 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1284 PPPPPPPPP 1258 PPPPPPPPP Sbjct: 871 PPPPPPPPP 879 Score = 29.5 bits (63), Expect = 6.1 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1284 PPPPPPPPP 1258 PPPPPPPPP Sbjct: 872 PPPPPPPPP 880 Score = 29.5 bits (63), Expect = 6.1 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1284 PPPPPPPPP 1258 PPPPPPPPP Sbjct: 873 PPPPPPPPP 881 Score = 29.5 bits (63), Expect = 6.1 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1284 PPPPPPPPP 1258 PPPPPPPPP Sbjct: 874 PPPPPPPPP 882 Score = 29.5 bits (63), Expect = 6.1 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1284 PPPPPPPPP 1258 PPPPPPPPP Sbjct: 875 PPPPPPPPP 883 Score = 29.5 bits (63), Expect = 6.1 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1284 PPPPPPPPP 1258 PPPPPPPPP Sbjct: 876 PPPPPPPPP 884 Score = 29.5 bits (63), Expect = 6.1 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1284 PPPPPPPPP 1258 PPPPPPPPP Sbjct: 877 PPPPPPPPP 885 Score = 23.8 bits (49), Expect(2) = 0.17 Identities = 7/7 (100%), Positives = 7/7 (100%) Frame = -2 Query: 1158 PPPPPPP 1138 PPPPPPP Sbjct: 872 PPPPPPP 878 Score = 23.8 bits (49), Expect(2) = 0.17 Identities = 7/7 (100%), Positives = 7/7 (100%) Frame = -2 Query: 1158 PPPPPPP 1138 PPPPPPP Sbjct: 873 PPPPPPP 879 >SB_43066| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 81 Score = 29.5 bits (63), Expect(2) = 0.23 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1284 PPPPPPPPP 1258 PPPPPPPPP Sbjct: 54 PPPPPPPPP 62 Score = 29.5 bits (63), Expect = 6.1 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1284 PPPPPPPPP 1258 PPPPPPPPP Sbjct: 55 PPPPPPPPP 63 Score = 29.5 bits (63), Expect = 6.1 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1284 PPPPPPPPP 1258 PPPPPPPPP Sbjct: 56 PPPPPPPPP 64 Score = 29.5 bits (63), Expect(2) = 0.23 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1284 PPPPPPPPP 1258 PPPPPPPPP Sbjct: 57 PPPPPPPPP 65 Score = 29.5 bits (63), Expect = 6.1 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1284 PPPPPPPPP 1258 PPPPPPPPP Sbjct: 58 PPPPPPPPP 66 Score = 29.5 bits (63), Expect(2) = 0.23 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1284 PPPPPPPPP 1258 PPPPPPPPP Sbjct: 59 PPPPPPPPP 67 Score = 29.5 bits (63), Expect = 6.1 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1284 PPPPPPPPP 1258 PPPPPPPPP Sbjct: 60 PPPPPPPPP 68 Score = 29.5 bits (63), Expect = 6.1 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1284 PPPPPPPPP 1258 PPPPPPPPP Sbjct: 61 PPPPPPPPP 69 Score = 29.5 bits (63), Expect = 6.1 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1284 PPPPPPPPP 1258 PPPPPPPPP Sbjct: 62 PPPPPPPPP 70 Score = 29.5 bits (63), Expect = 6.1 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1284 PPPPPPPPP 1258 PPPPPPPPP Sbjct: 63 PPPPPPPPP 71 Score = 23.8 bits (49), Expect(2) = 0.23 Identities = 7/7 (100%), Positives = 7/7 (100%) Frame = -2 Query: 1158 PPPPPPP 1138 PPPPPPP Sbjct: 59 PPPPPPP 65 Score = 23.8 bits (49), Expect(2) = 0.23 Identities = 7/7 (100%), Positives = 7/7 (100%) Frame = -2 Query: 1158 PPPPPPP 1138 PPPPPPP Sbjct: 60 PPPPPPP 66 Score = 23.8 bits (49), Expect(2) = 0.23 Identities = 7/7 (100%), Positives = 7/7 (100%) Frame = -2 Query: 1158 PPPPPPP 1138 PPPPPPP Sbjct: 64 PPPPPPP 70 >SB_56047| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 440 Score = 33.9 bits (74), Expect = 0.28 Identities = 17/46 (36%), Positives = 17/46 (36%) Frame = -3 Query: 1277 PPPPPPXXXXXXXXXXXXXXGGXGXXXPPXXXXXXXXXXPPPPPPP 1140 PPPPPP GG PP PPPPPPP Sbjct: 280 PPPPPPLTGGMLPPPF----GGHPAAAPPPPPLPAGVPAPPPPPPP 321 Score = 30.7 bits (66), Expect = 2.6 Identities = 16/46 (34%), Positives = 16/46 (34%) Frame = -2 Query: 1275 PPPPPPXXXXXXXXXXXXGGGGGXXXPXXXXXXXXXXXXPPPPPPP 1138 PPPPPP GG P PPPPPPP Sbjct: 280 PPPPPPLTGGMLPPPF---GGHPAAAPPPPPLPAGVPAPPPPPPPP 322 Score = 29.1 bits (62), Expect = 8.0 Identities = 14/47 (29%), Positives = 14/47 (29%) Frame = -2 Query: 1281 PPPPPPPPXXXXXXXXXXXXGGGGGXXXPXXXXXXXXXXXXPPPPPP 1141 P PPPP GG P PPPPPP Sbjct: 276 PTSQPPPPPPLTGGMLPPPFGGHPAAAPPPPPLPAGVPAPPPPPPPP 322 >SB_19987| Best HMM Match : MFMR (HMM E-Value=1.4) Length = 330 Score = 33.1 bits (72), Expect = 0.49 Identities = 17/50 (34%), Positives = 17/50 (34%), Gaps = 2/50 (4%) Frame = -3 Query: 1283 PPPPPPPP--XXXXXXXXXXXXXXGGXGXXXPPXXXXXXXXXXPPPPPPP 1140 PPPPPPPP PP PPPPPPP Sbjct: 280 PPPPPPPPSNTPGMFASSGFQPPPPPPTDFAPPPPPPEPTSELPPPPPPP 329 >SB_43690| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 780 Score = 32.7 bits (71), Expect = 0.65 Identities = 15/46 (32%), Positives = 15/46 (32%) Frame = -3 Query: 1280 PPPPPPPXXXXXXXXXXXXXXGGXGXXXPPXXXXXXXXXXPPPPPP 1143 PPPP PP GG PP PPPPP Sbjct: 684 PPPPAPPPPPIGGGDPTIWVSGGPPLSAPPLSSTLGPPPPAPPPPP 729 Score = 32.7 bits (71), Expect = 0.65 Identities = 17/49 (34%), Positives = 17/49 (34%) Frame = -2 Query: 1284 PPPPPPPPPXXXXXXXXXXXXGGGGGXXXPXXXXXXXXXXXXPPPPPPP 1138 PPPP PPPP GG P PPP PPP Sbjct: 684 PPPPAPPPPPIGGGDPTIWVSGG-----PPLSAPPLSSTLGPPPPAPPP 727 >SB_37803| Best HMM Match : WH2 (HMM E-Value=1.8e-10) Length = 514 Score = 32.3 bits (70), Expect = 0.86 Identities = 18/48 (37%), Positives = 18/48 (37%) Frame = -3 Query: 1283 PPPPPPPPXXXXXXXXXXXXXXGGXGXXXPPXXXXXXXXXXPPPPPPP 1140 PPPPPPPP GG PP PPPPPP Sbjct: 363 PPPPPPPPV-------------GGPPPPPPPIEGRPPSSLGNPPPPPP 397 Score = 30.3 bits (65), Expect = 3.5 Identities = 17/53 (32%), Positives = 17/53 (32%), Gaps = 6/53 (11%) Frame = -3 Query: 1283 PPPP------PPPPXXXXXXXXXXXXXXGGXGXXXPPXXXXXXXXXXPPPPPP 1143 PPPP PPPP G PP PPPPPP Sbjct: 328 PPPPSRSSQRPPPPSRGAPPPPSMGMAPPPVGGAAPPPPPPPPVGGPPPPPPP 380 Score = 29.1 bits (62), Expect = 8.0 Identities = 17/55 (30%), Positives = 17/55 (30%), Gaps = 6/55 (10%) Frame = -2 Query: 1284 PPPP------PPPPPXXXXXXXXXXXXGGGGGXXXPXXXXXXXXXXXXPPPPPPP 1138 PPPP PPPPP G PPPPPPP Sbjct: 316 PPPPARMGTAPPPPPPSRSSQRPPPPSRGAPPPPSMGMAPPPVGGAAPPPPPPPP 370 >SB_2012| Best HMM Match : Extensin_2 (HMM E-Value=0.1) Length = 305 Score = 31.9 bits (69), Expect = 1.1 Identities = 14/46 (30%), Positives = 14/46 (30%) Frame = -3 Query: 1277 PPPPPPXXXXXXXXXXXXXXGGXGXXXPPXXXXXXXXXXPPPPPPP 1140 PPPPPP P PPPPPPP Sbjct: 164 PPPPPPIAPAATVPAPAVPLAAASPPPPSGGPPPPPPPPPPPPPPP 209 Score = 30.3 bits (65), Expect = 3.5 Identities = 14/46 (30%), Positives = 14/46 (30%) Frame = -2 Query: 1275 PPPPPPXXXXXXXXXXXXGGGGGXXXPXXXXXXXXXXXXPPPPPPP 1138 PPPPPP P PPPPPPP Sbjct: 164 PPPPPPIAPAATVPAPAVPLAAASPPPPSGGPPPPPPPPPPPPPPP 209 Score = 29.5 bits (63), Expect = 6.1 Identities = 14/47 (29%), Positives = 14/47 (29%) Frame = -3 Query: 1283 PPPPPPPPXXXXXXXXXXXXXXGGXGXXXPPXXXXXXXXXXPPPPPP 1143 PPPPP P PP PPPPPP Sbjct: 110 PPPPPRAPETPSQAPSPPPPPTSPATRAPPPPPPIAPATGGPPPPPP 156 Score = 29.5 bits (63), Expect = 6.1 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1284 PPPPPPPPP 1258 PPPPPPPPP Sbjct: 195 PPPPPPPPP 203 Score = 29.5 bits (63), Expect = 6.1 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1284 PPPPPPPPP 1258 PPPPPPPPP Sbjct: 196 PPPPPPPPP 204 Score = 29.5 bits (63), Expect = 6.1 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1284 PPPPPPPPP 1258 PPPPPPPPP Sbjct: 197 PPPPPPPPP 205 Score = 29.5 bits (63), Expect = 6.1 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1284 PPPPPPPPP 1258 PPPPPPPPP Sbjct: 198 PPPPPPPPP 206 Score = 29.5 bits (63), Expect = 6.1 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1284 PPPPPPPPP 1258 PPPPPPPPP Sbjct: 199 PPPPPPPPP 207 Score = 29.5 bits (63), Expect = 6.1 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1284 PPPPPPPPP 1258 PPPPPPPPP Sbjct: 200 PPPPPPPPP 208 Score = 29.5 bits (63), Expect = 6.1 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1284 PPPPPPPPP 1258 PPPPPPPPP Sbjct: 201 PPPPPPPPP 209 >SB_58757| Best HMM Match : GRP (HMM E-Value=0.0041) Length = 154 Score = 31.1 bits (67), Expect = 2.0 Identities = 17/49 (34%), Positives = 17/49 (34%) Frame = +2 Query: 1139 GGGGGGGXXXXXXXXXXXXGXXXPPPPPXXXXXXXXXXXXGGGGGGGGG 1285 GGGGGGG G GGGGGGGGG Sbjct: 62 GGGGGGGGGGGGGGGGGGGGGGDDGDGGGGDGGGGGGGGDGGGGGGGGG 110 Score = 30.7 bits (66), Expect = 2.6 Identities = 17/49 (34%), Positives = 17/49 (34%) Frame = +2 Query: 1139 GGGGGGGXXXXXXXXXXXXGXXXPPPPPXXXXXXXXXXXXGGGGGGGGG 1285 GGGGGGG G GGGGGGGGG Sbjct: 63 GGGGGGGGGGGGGGGGGGGGGDDGDGGGGDGGGGGGGGDGGGGGGGGGG 111 Score = 30.7 bits (66), Expect = 2.6 Identities = 17/49 (34%), Positives = 17/49 (34%) Frame = +3 Query: 1140 GGGGGGGXXXXXXXXXXGXXXXPXPPXPXXXXXXXXXXXXGGGGGGGGG 1286 GGGGGGG G GGGGGGGGG Sbjct: 64 GGGGGGGGGGGGGGGGGGGGDDGDGGGGDGGGGGGGGDGGGGGGGGGGG 112 >SB_52222| Best HMM Match : SAPS (HMM E-Value=2.1e-37) Length = 1063 Score = 30.7 bits (66), Expect = 2.6 Identities = 17/49 (34%), Positives = 17/49 (34%) Frame = +2 Query: 1139 GGGGGGGXXXXXXXXXXXXGXXXPPPPPXXXXXXXXXXXXGGGGGGGGG 1285 GGGGGGG G GGGGGGGGG Sbjct: 818 GGGGGGGGDGGGYGDGGGFGDGGGYADGDGGGGGGGGGGGGGGGGGGGG 866 Score = 30.3 bits (65), Expect = 3.5 Identities = 17/49 (34%), Positives = 17/49 (34%) Frame = +3 Query: 1140 GGGGGGGXXXXXXXXXXGXXXXPXPPXPXXXXXXXXXXXXGGGGGGGGG 1286 GGGGGGG G GGGGGGGGG Sbjct: 814 GGGGGGGGGGGGDGGGYGDGGGFGDGGGYADGDGGGGGGGGGGGGGGGG 862 Score = 30.3 bits (65), Expect = 3.5 Identities = 17/49 (34%), Positives = 17/49 (34%) Frame = +2 Query: 1139 GGGGGGGXXXXXXXXXXXXGXXXPPPPPXXXXXXXXXXXXGGGGGGGGG 1285 GGGGGGG G GGGGGGGGG Sbjct: 815 GGGGGGGGGGGDGGGYGDGGGFGDGGGYADGDGGGGGGGGGGGGGGGGG 863 Score = 30.3 bits (65), Expect = 3.5 Identities = 17/49 (34%), Positives = 17/49 (34%) Frame = +2 Query: 1139 GGGGGGGXXXXXXXXXXXXGXXXPPPPPXXXXXXXXXXXXGGGGGGGGG 1285 GGGGGGG G GGGGGGGGG Sbjct: 816 GGGGGGGGGGDGGGYGDGGGFGDGGGYADGDGGGGGGGGGGGGGGGGGG 864 Score = 29.9 bits (64), Expect = 4.6 Identities = 17/49 (34%), Positives = 17/49 (34%) Frame = +3 Query: 1140 GGGGGGGXXXXXXXXXXGXXXXPXPPXPXXXXXXXXXXXXGGGGGGGGG 1286 GGGGGGG G GGGGGGGGG Sbjct: 812 GGGGGGGGGGGGGGDGGGYGDGGGFGDGGGYADGDGGGGGGGGGGGGGG 860 >SB_39784| Best HMM Match : WH2 (HMM E-Value=2e-05) Length = 480 Score = 30.3 bits (65), Expect = 3.5 Identities = 17/53 (32%), Positives = 17/53 (32%), Gaps = 4/53 (7%) Frame = -2 Query: 1284 PPPPPPPPPXXXXXXXXXXXXGGG----GGXXXPXXXXXXXXXXXXPPPPPPP 1138 PPPPP P G GG P PPPPPPP Sbjct: 341 PPPPPISKPPTSTRSAPPPPPGRAPQPLGGPPPPPPGRRPPSGKINPPPPPPP 393 Score = 29.5 bits (63), Expect = 6.1 Identities = 16/51 (31%), Positives = 16/51 (31%), Gaps = 4/51 (7%) Frame = -3 Query: 1283 PPP----PPPPPXXXXXXXXXXXXXXGGXGXXXPPXXXXXXXXXXPPPPPP 1143 PPP PPPPP G PP PPPPP Sbjct: 311 PPPLNATPPPPPPSRDQVPLPPPPLRGQIAPPPPPISKPPTSTRSAPPPPP 361 >SB_18024| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 831 Score = 30.3 bits (65), Expect = 3.5 Identities = 14/45 (31%), Positives = 14/45 (31%) Frame = -3 Query: 1277 PPPPPPXXXXXXXXXXXXXXGGXGXXXPPXXXXXXXXXXPPPPPP 1143 PPPPPP PP PPPPPP Sbjct: 25 PPPPPPTRPFERNIHPRTEPRDRERPPPPPPPRFYDNDIPPPPPP 69 >SB_10535| Best HMM Match : Extensin_2 (HMM E-Value=0.013) Length = 392 Score = 30.3 bits (65), Expect = 3.5 Identities = 17/53 (32%), Positives = 17/53 (32%), Gaps = 4/53 (7%) Frame = -2 Query: 1284 PPPPPPPPPXXXXXXXXXXXXGGG----GGXXXPXXXXXXXXXXXXPPPPPPP 1138 PPPPP P G GG P PPPPPPP Sbjct: 253 PPPPPISKPPTSTRSAPPPPPGRAPQPLGGPPPPPPGRRPPSGKINPPPPPPP 305 Score = 29.5 bits (63), Expect = 6.1 Identities = 16/51 (31%), Positives = 16/51 (31%), Gaps = 4/51 (7%) Frame = -3 Query: 1283 PPP----PPPPPXXXXXXXXXXXXXXGGXGXXXPPXXXXXXXXXXPPPPPP 1143 PPP PPPPP G PP PPPPP Sbjct: 223 PPPLNATPPPPPPSRDQVPLPPPPLRGQIAPPPPPISKPPTSTRSAPPPPP 273 >SB_53582| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 393 Score = 30.3 bits (65), Expect = 3.5 Identities = 16/49 (32%), Positives = 16/49 (32%) Frame = -2 Query: 1284 PPPPPPPPPXXXXXXXXXXXXGGGGGXXXPXXXXXXXXXXXXPPPPPPP 1138 PPPPPPPPP PPPPPPP Sbjct: 102 PPPPPPPPPPPPPPPPPPPIT-----LHHEQHVVSHVMHPAPPPPPPPP 145 Score = 29.5 bits (63), Expect = 6.1 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1284 PPPPPPPPP 1258 PPPPPPPPP Sbjct: 138 PPPPPPPPP 146 >SB_21376| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 290 Score = 30.3 bits (65), Expect = 3.5 Identities = 15/49 (30%), Positives = 15/49 (30%) Frame = -2 Query: 1284 PPPPPPPPPXXXXXXXXXXXXGGGGGXXXPXXXXXXXXXXXXPPPPPPP 1138 PPPP PPPP P PPPP PP Sbjct: 162 PPPPNPPPPNAPYPPPPYPPPPNPPYPPPPNPPYPPPPNAPNPPPPNPP 210 >SB_55818| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 145 Score = 29.9 bits (64), Expect = 4.6 Identities = 14/49 (28%), Positives = 14/49 (28%) Frame = -2 Query: 1284 PPPPPPPPPXXXXXXXXXXXXGGGGGXXXPXXXXXXXXXXXXPPPPPPP 1138 PPPPPP PP P PPPPP Sbjct: 50 PPPPPPSPPAAAPAAPPPPAAAPAAPPPPAAPPAAPPPPPPLPAPPPPP 98 >SB_11023| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 669 Score = 29.9 bits (64), Expect = 4.6 Identities = 18/51 (35%), Positives = 18/51 (35%), Gaps = 3/51 (5%) Frame = -3 Query: 1283 PPPP---PPPPXXXXXXXXXXXXXXGGXGXXXPPXXXXXXXXXXPPPPPPP 1140 PPPP PPPP G PP PPPPPPP Sbjct: 367 PPPPTNKPPPPPPPTNGPPPPPPPTNGPPPPPPPTNG-------PPPPPPP 410 >SB_44752| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 421 Score = 26.6 bits (56), Expect(2) = 5.5 Identities = 8/8 (100%), Positives = 8/8 (100%) Frame = -3 Query: 1283 PPPPPPPP 1260 PPPPPPPP Sbjct: 210 PPPPPPPP 217 Score = 21.4 bits (43), Expect(2) = 5.5 Identities = 8/19 (42%), Positives = 8/19 (42%) Frame = -3 Query: 1196 PPXXXXXXXXXXPPPPPPP 1140 PP PPPPPP Sbjct: 216 PPEDDSIHNHEDLPPPPPP 234 >SB_47784| Best HMM Match : Ank (HMM E-Value=1.4e-08) Length = 593 Score = 29.5 bits (63), Expect = 6.1 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1284 PPPPPPPPP 1258 PPPPPPPPP Sbjct: 464 PPPPPPPPP 472 Score = 29.5 bits (63), Expect = 6.1 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1284 PPPPPPPPP 1258 PPPPPPPPP Sbjct: 465 PPPPPPPPP 473 Score = 29.5 bits (63), Expect = 6.1 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1284 PPPPPPPPP 1258 PPPPPPPPP Sbjct: 466 PPPPPPPPP 474 Score = 29.5 bits (63), Expect = 6.1 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1284 PPPPPPPPP 1258 PPPPPPPPP Sbjct: 467 PPPPPPPPP 475 Score = 29.5 bits (63), Expect = 6.1 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1284 PPPPPPPPP 1258 PPPPPPPPP Sbjct: 468 PPPPPPPPP 476 Score = 29.5 bits (63), Expect = 6.1 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1284 PPPPPPPPP 1258 PPPPPPPPP Sbjct: 469 PPPPPPPPP 477 Score = 29.5 bits (63), Expect = 6.1 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1284 PPPPPPPPP 1258 PPPPPPPPP Sbjct: 470 PPPPPPPPP 478 Score = 29.5 bits (63), Expect = 6.1 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1284 PPPPPPPPP 1258 PPPPPPPPP Sbjct: 471 PPPPPPPPP 479 Score = 29.5 bits (63), Expect = 6.1 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1284 PPPPPPPPP 1258 PPPPPPPPP Sbjct: 472 PPPPPPPPP 480 Score = 29.5 bits (63), Expect = 6.1 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1284 PPPPPPPPP 1258 PPPPPPPPP Sbjct: 473 PPPPPPPPP 481 Score = 29.5 bits (63), Expect = 6.1 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1284 PPPPPPPPP 1258 PPPPPPPPP Sbjct: 474 PPPPPPPPP 482 Score = 29.5 bits (63), Expect = 6.1 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1284 PPPPPPPPP 1258 PPPPPPPPP Sbjct: 475 PPPPPPPPP 483 Score = 29.5 bits (63), Expect = 6.1 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1284 PPPPPPPPP 1258 PPPPPPPPP Sbjct: 476 PPPPPPPPP 484 Score = 29.5 bits (63), Expect = 6.1 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1284 PPPPPPPPP 1258 PPPPPPPPP Sbjct: 477 PPPPPPPPP 485 Score = 29.5 bits (63), Expect = 6.1 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1284 PPPPPPPPP 1258 PPPPPPPPP Sbjct: 478 PPPPPPPPP 486 Score = 29.5 bits (63), Expect = 6.1 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1284 PPPPPPPPP 1258 PPPPPPPPP Sbjct: 479 PPPPPPPPP 487 >SB_47508| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2143 Score = 29.5 bits (63), Expect = 6.1 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1284 PPPPPPPPP 1258 PPPPPPPPP Sbjct: 82 PPPPPPPPP 90 >SB_47282| Best HMM Match : RCSD (HMM E-Value=0.53) Length = 264 Score = 29.5 bits (63), Expect = 6.1 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1284 PPPPPPPPP 1258 PPPPPPPPP Sbjct: 79 PPPPPPPPP 87 Score = 29.5 bits (63), Expect = 6.1 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1284 PPPPPPPPP 1258 PPPPPPPPP Sbjct: 80 PPPPPPPPP 88 Score = 29.5 bits (63), Expect = 6.1 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1284 PPPPPPPPP 1258 PPPPPPPPP Sbjct: 81 PPPPPPPPP 89 Score = 29.5 bits (63), Expect = 6.1 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1284 PPPPPPPPP 1258 PPPPPPPPP Sbjct: 82 PPPPPPPPP 90 Score = 29.5 bits (63), Expect = 6.1 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1284 PPPPPPPPP 1258 PPPPPPPPP Sbjct: 83 PPPPPPPPP 91 Score = 29.5 bits (63), Expect = 6.1 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1284 PPPPPPPPP 1258 PPPPPPPPP Sbjct: 84 PPPPPPPPP 92 Score = 29.5 bits (63), Expect = 6.1 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1284 PPPPPPPPP 1258 PPPPPPPPP Sbjct: 85 PPPPPPPPP 93 >SB_42034| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 504 Score = 29.5 bits (63), Expect = 6.1 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1284 PPPPPPPPP 1258 PPPPPPPPP Sbjct: 5 PPPPPPPPP 13 >SB_29861| Best HMM Match : RRM_1 (HMM E-Value=1.10002e-42) Length = 1531 Score = 29.5 bits (63), Expect = 6.1 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1284 PPPPPPPPP 1258 PPPPPPPPP Sbjct: 818 PPPPPPPPP 826 Score = 29.5 bits (63), Expect = 6.1 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1284 PPPPPPPPP 1258 PPPPPPPPP Sbjct: 819 PPPPPPPPP 827 Score = 29.5 bits (63), Expect = 6.1 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1284 PPPPPPPPP 1258 PPPPPPPPP Sbjct: 820 PPPPPPPPP 828 >SB_21275| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 327 Score = 29.5 bits (63), Expect = 6.1 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1284 PPPPPPPPP 1258 PPPPPPPPP Sbjct: 187 PPPPPPPPP 195 >SB_20622| Best HMM Match : zf-CHC2 (HMM E-Value=0.64) Length = 276 Score = 29.5 bits (63), Expect = 6.1 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1284 PPPPPPPPP 1258 PPPPPPPPP Sbjct: 68 PPPPPPPPP 76 Score = 29.5 bits (63), Expect = 6.1 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1284 PPPPPPPPP 1258 PPPPPPPPP Sbjct: 69 PPPPPPPPP 77 >SB_19504| Best HMM Match : FH2 (HMM E-Value=1.2e-30) Length = 739 Score = 29.5 bits (63), Expect = 6.1 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1284 PPPPPPPPP 1258 PPPPPPPPP Sbjct: 195 PPPPPPPPP 203 Score = 29.5 bits (63), Expect = 6.1 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1284 PPPPPPPPP 1258 PPPPPPPPP Sbjct: 196 PPPPPPPPP 204 >SB_11994| Best HMM Match : ERM (HMM E-Value=0.28) Length = 465 Score = 29.5 bits (63), Expect = 6.1 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1284 PPPPPPPPP 1258 PPPPPPPPP Sbjct: 280 PPPPPPPPP 288 Score = 29.5 bits (63), Expect = 6.1 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1284 PPPPPPPPP 1258 PPPPPPPPP Sbjct: 281 PPPPPPPPP 289 Score = 29.5 bits (63), Expect = 6.1 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1284 PPPPPPPPP 1258 PPPPPPPPP Sbjct: 282 PPPPPPPPP 290 Score = 29.5 bits (63), Expect = 6.1 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1284 PPPPPPPPP 1258 PPPPPPPPP Sbjct: 283 PPPPPPPPP 291 Score = 29.5 bits (63), Expect = 6.1 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1284 PPPPPPPPP 1258 PPPPPPPPP Sbjct: 284 PPPPPPPPP 292 Score = 29.5 bits (63), Expect = 6.1 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1284 PPPPPPPPP 1258 PPPPPPPPP Sbjct: 285 PPPPPPPPP 293 Score = 29.5 bits (63), Expect = 6.1 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1284 PPPPPPPPP 1258 PPPPPPPPP Sbjct: 286 PPPPPPPPP 294 >SB_11868| Best HMM Match : zf-CHC2 (HMM E-Value=0.64) Length = 500 Score = 29.5 bits (63), Expect = 6.1 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1284 PPPPPPPPP 1258 PPPPPPPPP Sbjct: 292 PPPPPPPPP 300 Score = 29.5 bits (63), Expect = 6.1 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1284 PPPPPPPPP 1258 PPPPPPPPP Sbjct: 293 PPPPPPPPP 301 >SB_9896| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 393 Score = 29.5 bits (63), Expect = 6.1 Identities = 14/48 (29%), Positives = 14/48 (29%) Frame = -3 Query: 1283 PPPPPPPPXXXXXXXXXXXXXXGGXGXXXPPXXXXXXXXXXPPPPPPP 1140 PP PP PP PP PPPPP P Sbjct: 161 PPQPPAPPAAPFMAPAAPPAPPPPGAPAAPPAPPFGGPPSAPPPPPAP 208 >SB_52556| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 255 Score = 29.5 bits (63), Expect = 6.1 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1284 PPPPPPPPP 1258 PPPPPPPPP Sbjct: 241 PPPPPPPPP 249 >SB_44647| Best HMM Match : C_tripleX (HMM E-Value=0.00011) Length = 812 Score = 29.5 bits (63), Expect = 6.1 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1284 PPPPPPPPP 1258 PPPPPPPPP Sbjct: 457 PPPPPPPPP 465 >SB_44156| Best HMM Match : Extensin_2 (HMM E-Value=0.05) Length = 1878 Score = 29.5 bits (63), Expect = 6.1 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1284 PPPPPPPPP 1258 PPPPPPPPP Sbjct: 1311 PPPPPPPPP 1319 Score = 29.5 bits (63), Expect = 6.1 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1284 PPPPPPPPP 1258 PPPPPPPPP Sbjct: 1312 PPPPPPPPP 1320 Score = 29.5 bits (63), Expect = 6.1 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1284 PPPPPPPPP 1258 PPPPPPPPP Sbjct: 1313 PPPPPPPPP 1321 Score = 29.5 bits (63), Expect = 6.1 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1284 PPPPPPPPP 1258 PPPPPPPPP Sbjct: 1314 PPPPPPPPP 1322 Score = 29.5 bits (63), Expect = 6.1 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1284 PPPPPPPPP 1258 PPPPPPPPP Sbjct: 1315 PPPPPPPPP 1323 Score = 29.5 bits (63), Expect = 6.1 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1284 PPPPPPPPP 1258 PPPPPPPPP Sbjct: 1316 PPPPPPPPP 1324 Score = 29.5 bits (63), Expect = 6.1 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1284 PPPPPPPPP 1258 PPPPPPPPP Sbjct: 1317 PPPPPPPPP 1325 >SB_42380| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1430 Score = 29.5 bits (63), Expect = 6.1 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1284 PPPPPPPPP 1258 PPPPPPPPP Sbjct: 794 PPPPPPPPP 802 Score = 29.5 bits (63), Expect = 6.1 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1284 PPPPPPPPP 1258 PPPPPPPPP Sbjct: 795 PPPPPPPPP 803 Score = 29.5 bits (63), Expect = 6.1 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1284 PPPPPPPPP 1258 PPPPPPPPP Sbjct: 796 PPPPPPPPP 804 Score = 29.5 bits (63), Expect = 6.1 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1284 PPPPPPPPP 1258 PPPPPPPPP Sbjct: 797 PPPPPPPPP 805 >SB_38456| Best HMM Match : BTB (HMM E-Value=8.8e-26) Length = 1410 Score = 29.5 bits (63), Expect = 6.1 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1284 PPPPPPPPP 1258 PPPPPPPPP Sbjct: 359 PPPPPPPPP 367 Score = 29.5 bits (63), Expect = 6.1 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1284 PPPPPPPPP 1258 PPPPPPPPP Sbjct: 360 PPPPPPPPP 368 >SB_18739| Best HMM Match : YhhN (HMM E-Value=7.3) Length = 306 Score = 29.5 bits (63), Expect = 6.1 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1284 PPPPPPPPP 1258 PPPPPPPPP Sbjct: 252 PPPPPPPPP 260 Score = 29.5 bits (63), Expect = 6.1 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1284 PPPPPPPPP 1258 PPPPPPPPP Sbjct: 253 PPPPPPPPP 261 >SB_11420| Best HMM Match : MBOAT (HMM E-Value=6.9e-06) Length = 628 Score = 29.5 bits (63), Expect = 6.1 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1284 PPPPPPPPP 1258 PPPPPPPPP Sbjct: 211 PPPPPPPPP 219 Score = 29.5 bits (63), Expect = 6.1 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1284 PPPPPPPPP 1258 PPPPPPPPP Sbjct: 212 PPPPPPPPP 220 Score = 29.5 bits (63), Expect = 6.1 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1284 PPPPPPPPP 1258 PPPPPPPPP Sbjct: 213 PPPPPPPPP 221 Score = 29.5 bits (63), Expect = 6.1 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1284 PPPPPPPPP 1258 PPPPPPPPP Sbjct: 214 PPPPPPPPP 222 Score = 29.5 bits (63), Expect = 6.1 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1284 PPPPPPPPP 1258 PPPPPPPPP Sbjct: 215 PPPPPPPPP 223 Score = 29.5 bits (63), Expect = 6.1 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1284 PPPPPPPPP 1258 PPPPPPPPP Sbjct: 216 PPPPPPPPP 224 >SB_5350| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 522 Score = 29.5 bits (63), Expect = 6.1 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1284 PPPPPPPPP 1258 PPPPPPPPP Sbjct: 378 PPPPPPPPP 386 Score = 29.5 bits (63), Expect = 6.1 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1284 PPPPPPPPP 1258 PPPPPPPPP Sbjct: 379 PPPPPPPPP 387 Score = 29.5 bits (63), Expect = 6.1 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1284 PPPPPPPPP 1258 PPPPPPPPP Sbjct: 380 PPPPPPPPP 388 >SB_35885| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 476 Score = 29.1 bits (62), Expect = 8.0 Identities = 16/47 (34%), Positives = 16/47 (34%) Frame = -3 Query: 1280 PPPPPPPXXXXXXXXXXXXXXGGXGXXXPPXXXXXXXXXXPPPPPPP 1140 PPPP PP G PP PPPPPPP Sbjct: 400 PPPPGPPMLNMAPSIPPWQTTPGYIPPPPPGFPQFQ----PPPPPPP 442 >SB_18993| Best HMM Match : DEAD (HMM E-Value=9.3e-41) Length = 690 Score = 23.8 bits (49), Expect(2) = 8.8 Identities = 7/7 (100%), Positives = 7/7 (100%) Frame = -2 Query: 1284 PPPPPPP 1264 PPPPPPP Sbjct: 507 PPPPPPP 513 Score = 23.4 bits (48), Expect(2) = 8.8 Identities = 7/8 (87%), Positives = 7/8 (87%) Frame = -2 Query: 1281 PPPPPPPP 1258 P PPPPPP Sbjct: 536 PAPPPPPP 543 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 24,605,146 Number of Sequences: 59808 Number of extensions: 414193 Number of successful extensions: 13497 Number of sequences better than 10.0: 47 Number of HSP's better than 10.0 without gapping: 529 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5782 length of database: 16,821,457 effective HSP length: 84 effective length of database: 11,797,585 effective search space used: 4058369240 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -