BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= FWDP01_FL5_P12 (1288 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AB002337-1|BAA20797.2| 1709|Homo sapiens KIAA0339 protein protein. 39 0.034 DQ067453-1|AAZ23040.1| 1262|Homo sapiens diaphanous-1 protein. 37 0.14 BC117257-1|AAI17258.1| 1262|Homo sapiens diaphanous homolog 1 (D... 37 0.14 AY363395-1|AAQ63049.1| 1272|Homo sapiens diaphanous 1 protein. 37 0.14 AK023345-1|BAB14533.1| 533|Homo sapiens protein ( Homo sapiens ... 37 0.14 AB209482-1|BAD92719.1| 1299|Homo sapiens Diaphanous 1 variant pr... 37 0.14 U19927-1|AAC50140.1| 502|Homo sapiens WAS protein. 36 0.24 U12707-1|AAA62663.1| 502|Homo sapiens Wiskott-Aldrich syndrome ... 36 0.24 BC012738-1|AAH12738.1| 502|Homo sapiens Wiskott-Aldrich syndrom... 36 0.24 BC002961-1|AAH02961.1| 514|Homo sapiens WAS protein protein. 36 0.24 AF115549-1|AAD26691.1| 502|Homo sapiens Wiskott-Aldrich Syndrom... 36 0.24 AB033031-1|BAA86519.1| 1217|Homo sapiens KIAA1205 protein protein. 36 0.32 BC040943-1|AAH40943.1| 498|Homo sapiens WAS protein family, mem... 36 0.42 AL096774-6|CAC18518.1| 498|Homo sapiens WAS protein family, mem... 36 0.42 AB026542-1|BAA81795.1| 498|Homo sapiens WASP-family protein pro... 36 0.42 AF105378-1|AAD30210.2| 456|Homo sapiens heparan sulfate 3-O-sul... 29 0.49 AY476736-1|AAS58324.1| 244|Homo sapiens heparan sulfate 3-O-sul... 29 0.51 AF528529-1|AAM94279.1| 502|Homo sapiens hypothetical protein pr... 27 0.63 BC087835-1|AAH87835.1| 338|Homo sapiens FAM44A protein protein. 27 0.65 BC065546-1|AAH65546.1| 338|Homo sapiens FAM44A protein protein. 27 0.65 AB083343-1|BAE96598.1| 3599|Homo sapiens zinc-finger homeodomain... 29 0.72 AL834396-1|CAD39058.1| 1009|Homo sapiens hypothetical protein pr... 35 0.74 AB067489-1|BAB67795.1| 1112|Homo sapiens KIAA1902 protein protein. 35 0.74 AB051500-1|BAB21804.2| 1652|Homo sapiens KIAA1713 protein protein. 29 0.76 AB005297-1|BAA23647.1| 1584|Homo sapiens BAI 1 protein. 29 0.76 AY494951-1|AAS82582.1| 1250|Homo sapiens lamellipodin protein. 29 0.77 AJ584699-1|CAE48361.1| 1250|Homo sapiens RAPH1 protein protein. 29 0.77 AB051468-1|BAB21772.1| 1236|Homo sapiens KIAA1681 protein protein. 29 0.77 AL096764-2|CAM28218.1| 1137|Homo sapiens chromosome X open readi... 29 0.78 AL049563-1|CAM28289.1| 1137|Homo sapiens chromosome X open readi... 29 0.78 BC117407-1|AAI17408.1| 1081|Homo sapiens LOC152485 protein protein. 29 0.78 AK091130-1|BAC03591.1| 1077|Homo sapiens protein ( Homo sapiens ... 29 0.78 AB023231-1|BAA76858.2| 1050|Homo sapiens KIAA1014 protein protein. 29 0.78 BC037404-1|AAH37404.1| 1015|Homo sapiens formin binding protein ... 29 0.78 AY827075-1|AAV87312.1| 927|Homo sapiens F-box protein 11 protein. 29 0.79 BC043258-1|AAH43258.2| 915|Homo sapiens FBXO11 protein protein. 29 0.79 BC000401-1|AAH00401.2| 894|Homo sapiens SF3B2 protein protein. 29 0.79 BC053577-1|AAH53577.1| 877|Homo sapiens SF3B2 protein protein. 29 0.79 BC052781-1|AAH52781.1| 802|Homo sapiens RANBP9 protein protein. 29 0.80 BX537771-1|CAD97834.1| 799|Homo sapiens hypothetical protein pr... 29 0.80 AK091683-1|BAC03720.1| 749|Homo sapiens protein ( Homo sapiens ... 29 0.80 U88666-1|AAC05299.1| 686|Homo sapiens serine kinase SRPK2 protein. 29 0.80 BC068547-1|AAH68547.1| 688|Homo sapiens SRPK2 protein protein. 29 0.80 BC035214-1|AAH35214.1| 688|Homo sapiens SFRS protein kinase 2 p... 29 0.80 AC005070-2|AAC29140.1| 675|Homo sapiens serine kinase SRPK2 pro... 29 0.81 AC005070-1|AAC29141.1| 675|Homo sapiens WUGSC:H_RG152G17.1a pro... 29 0.81 AY950679-1|AAY34147.1| 659|Homo sapiens MEX3C protein. 29 0.81 AK056450-1|BAB71186.1| 568|Homo sapiens protein ( Homo sapiens ... 29 0.81 AK022987-1|BAB14348.1| 560|Homo sapiens protein ( Homo sapiens ... 29 0.82 AY354201-1|AAQ63886.1| 546|Homo sapiens SFRS protein kinase 2 i... 29 0.82 AK123671-1|BAC85674.1| 520|Homo sapiens protein ( Homo sapiens ... 29 0.82 BC044311-1|AAH44311.2| 399|Homo sapiens hypothetical protein LO... 29 0.83 AL078621-10|CAB81647.1| 232|Homo sapiens protein ( G islands. ... 29 0.87 AF174599-1|AAF04520.1| 197|Homo sapiens F-box protein Fbx11 pro... 29 0.88 AF176706-1|AAF17611.1| 192|Homo sapiens F-box protein FBX11 pro... 29 0.89 AY225516-1|AAO74853.1| 153|Homo sapiens acetylcholinesterase me... 29 0.91 AY225517-1|AAO74854.1| 124|Homo sapiens acetylcholinesterase me... 29 0.94 AL355338-1|CAH70366.2| 663|Homo sapiens Zic family member 5 (od... 34 0.97 AF378304-1|AAK55418.1| 639|Homo sapiens zinc family member 5 pr... 34 0.97 D88460-1|BAA20128.1| 505|Homo sapiens N-WASP protein. 34 1.3 BC052955-1|AAH52955.1| 505|Homo sapiens Wiskott-Aldrich syndrom... 34 1.3 AM295156-1|CAL26602.1| 505|Homo sapiens WASL protein protein. 34 1.3 AC006333-1|AAQ96857.1| 505|Homo sapiens unknown protein. 34 1.3 BC038446-1|AAH38446.1| 673|Homo sapiens SF1 protein protein. 33 1.7 DQ067452-1|AAZ23039.1| 229|Homo sapiens diaphanous-1 protein. 33 2.2 AY360322-1|AAQ64023.1| 179|Homo sapiens diaphanous 1 protein. 33 2.2 AY260762-1|AAP20225.1| 3567|Homo sapiens zinc finger homeodomain... 33 2.2 AF051782-1|AAC05373.1| 1248|Homo sapiens diaphanous 1 protein. 33 2.2 Z86061-3|CAI42258.1| 1096|Homo sapiens diaphanous homolog 2 (Dro... 33 3.0 Z86061-2|CAI42257.1| 1101|Homo sapiens diaphanous homolog 2 (Dro... 33 3.0 Y15909-1|CAA75870.1| 1101|Homo sapiens DIA-156 protein protein. 33 3.0 Y15908-1|CAA75869.1| 1096|Homo sapiens DIA-12C protein protein. 33 3.0 BC117414-1|AAI17415.1| 1103|Homo sapiens DIAPH2 protein protein. 33 3.0 BC034003-1|AAH34003.1| 600|Homo sapiens PRR12 protein protein. 33 3.0 AL669876-2|CAH71114.1| 1096|Homo sapiens diaphanous homolog 2 (D... 33 3.0 AL669876-1|CAH71113.1| 1101|Homo sapiens diaphanous homolog 2 (D... 33 3.0 AL606530-3|CAI39842.1| 1096|Homo sapiens diaphanous homolog 2 (D... 33 3.0 AL606530-2|CAI39841.1| 1101|Homo sapiens diaphanous homolog 2 (D... 33 3.0 AL592157-3|CAI40545.1| 1096|Homo sapiens diaphanous homolog 2 (D... 33 3.0 AL592157-2|CAI40544.1| 1101|Homo sapiens diaphanous homolog 2 (D... 33 3.0 AL391821-1|CAH71361.1| 1101|Homo sapiens diaphanous homolog 2 (D... 33 3.0 AL161624-2|CAI40916.1| 1096|Homo sapiens diaphanous homolog 2 (D... 33 3.0 AL161624-1|CAI40915.1| 1101|Homo sapiens diaphanous homolog 2 (D... 33 3.0 AL139809-2|CAD13477.2| 1096|Homo sapiens diaphanous homolog 2 (D... 33 3.0 AL139809-1|CAI39928.1| 1101|Homo sapiens diaphanous homolog 2 (D... 33 3.0 AL031053-2|CAB39108.2| 1096|Homo sapiens diaphanous homolog 2 (D... 33 3.0 AL031053-1|CAI42515.1| 1101|Homo sapiens diaphanous homolog 2 (D... 33 3.0 BC073988-1|AAH73988.1| 682|Homo sapiens FMNL1 protein protein. 32 3.9 BC054516-1|AAH54516.1| 666|Homo sapiens amyloid beta (A4) precu... 32 3.9 AY278319-1|AAP32476.1| 1100|Homo sapiens leukocyte formin protein. 32 3.9 AY152730-1|AAN75525.1| 665|Homo sapiens Rap1-interacting adapto... 32 3.9 AL160287-2|CAH70339.1| 666|Homo sapiens amyloid beta (A4) precu... 32 3.9 AF432213-1|AAL99920.1| 991|Homo sapiens CLL-associated antigen ... 32 3.9 AB085852-1|BAC41256.1| 666|Homo sapiens proline-rich protein 73... 32 3.9 AB058759-1|BAB47485.1| 1134|Homo sapiens KIAA1856 protein protein. 32 5.2 X66188-1|CAA46956.1| 421|Homo sapiens proacrosin protein. 27 5.2 X54017-1|CAA37964.1| 421|Homo sapiens preproacrosin protein. 27 5.2 M77381-1|AAA51575.1| 184|Homo sapiens acrosin protein. 27 5.6 AB067470-1|BAB67776.1| 1480|Homo sapiens KIAA1883 protein protein. 26 6.2 AK024444-1|BAB15734.1| 1343|Homo sapiens FLJ00034 protein protein. 26 6.2 BC053992-1|AAH53992.1| 1312|Homo sapiens SR-related CTD-associat... 26 6.2 AF254411-1|AAF87552.1| 1312|Homo sapiens ser/arg-rich pre-mRNA s... 26 6.2 AB208788-1|BAD92025.1| 960|Homo sapiens Retinoblastoma-associat... 26 6.4 M33647-1|AAA69806.1| 928|Homo sapiens RB1 protein. 26 6.4 M28419-1|AAA69808.1| 928|Homo sapiens MIC2 protein. 26 6.4 M27866-1|AAA53484.1| 928|Homo sapiens retinoblastoma susceptibi... 26 6.4 M15400-1|AAA69807.1| 928|Homo sapiens RB1 protein. 26 6.4 L41870-1|AAB59465.1| 928|Homo sapiens retinoblastoma suspectibi... 26 6.4 L11910-1|AAA53483.1| 928|Homo sapiens retinoblastoma susceptibi... 26 6.4 BC040540-1|AAH40540.1| 928|Homo sapiens retinoblastoma 1 (inclu... 26 6.4 BC039060-1|AAH39060.1| 928|Homo sapiens retinoblastoma 1 (inclu... 26 6.4 AL392048-1|CAH72243.1| 928|Homo sapiens retinoblastoma 1 (inclu... 26 6.4 AL136960-1|CAH70901.1| 928|Homo sapiens retinoblastoma 1 (inclu... 26 6.4 AF551763-1|AAN64133.1| 928|Homo sapiens retinoblastoma 1 (inclu... 26 6.4 AJ133727-1|CAB42630.1| 889|Homo sapiens hyperpolarization-activ... 26 6.4 AJ012582-1|CAB42602.1| 889|Homo sapiens hyperpolarization-activ... 26 6.4 AB028999-1|BAA83028.1| 804|Homo sapiens KIAA1076 protein protein. 26 6.4 AK095189-1|BAC04495.1| 634|Homo sapiens protein ( Homo sapiens ... 26 6.6 BC023587-1|AAH23587.1| 523|Homo sapiens REST corepressor 2 prot... 26 6.7 BC095481-1|AAH95481.1| 591|Homo sapiens enabled homolog (Drosop... 31 6.9 BC065238-1|AAH65238.1| 527|Homo sapiens ENAH protein protein. 31 6.9 AY374131-1|AAQ82697.1| 275|Homo sapiens truncated C1-tetrahydro... 31 6.9 AY374130-1|AAQ82696.1| 978|Homo sapiens C1-tetrahydrofolate syn... 31 6.9 AY345143-1|AAR04685.1| 570|Homo sapiens MENA protein. 31 6.9 AY157990-1|AAN76325.1| 1778|Homo sapiens myeloid/lymphoid or mix... 31 6.9 AY147037-1|AAN17675.1| 1858|Homo sapiens MLL5 protein. 31 6.9 AL591380-2|CAH71476.1| 570|Homo sapiens enabled homolog (Drosop... 31 6.9 AL591380-1|CAH71475.1| 817|Homo sapiens enabled homolog (Drosop... 31 6.9 AL356216-3|CAI22019.1| 570|Homo sapiens enabled homolog (Drosop... 31 6.9 AL356216-2|CAI22020.1| 817|Homo sapiens enabled homolog (Drosop... 31 6.9 AL133260-2|CAI95678.1| 978|Homo sapiens methylenetetrahydrofola... 31 6.9 AL049694-3|CAI95774.1| 978|Homo sapiens methylenetetrahydrofola... 31 6.9 AL035086-7|CAI42794.1| 978|Homo sapiens methylenetetrahydrofola... 31 6.9 AK096246-1|BAC04736.1| 467|Homo sapiens protein ( Homo sapiens ... 31 6.9 AJ509090-1|CAD48858.1| 625|Homo sapiens Wiskott-Aldrich syndrom... 31 6.9 AF519769-1|AAQ08487.1| 591|Homo sapiens mena protein protein. 31 6.9 AF519459-1|AAM74947.1| 1858|Homo sapiens MLL5 protein. 31 6.9 AF134304-1|AAD33053.2| 496|Homo sapiens Scar2 protein. 31 6.9 AB127387-1|BAD93193.1| 978|Homo sapiens mitochondrial C1-tetrah... 31 6.9 AF134053-1|AAD55891.1| 355|Homo sapiens Kruppel-like factor LKL... 26 6.9 AK126559-1|BAC86594.1| 308|Homo sapiens protein ( Homo sapiens ... 26 7.0 BC010608-1|AAH10608.1| 305|Homo sapiens RCOR2 protein protein. 26 7.0 AB023171-1|BAA76798.2| 1183|Homo sapiens KIAA0954 protein protein. 26 8.1 AF086762-1|AAF28400.1| 1111|Homo sapiens C11orf9 protein. 26 8.2 AL591502-3|CAI12581.1| 941|Homo sapiens gamma-aminobutyric acid... 26 8.3 AL445495-1|CAD13322.2| 941|Homo sapiens gamma-aminobutyric acid... 26 8.3 AL356282-1|CAH72233.1| 941|Homo sapiens gamma-aminobutyric acid... 26 8.3 AL353782-5|CAH71298.1| 941|Homo sapiens gamma-aminobutyric acid... 26 8.3 AJ012188-1|CAA09942.1| 941|Homo sapiens GABAB receptor, subunit... 26 8.3 AF099033-1|AAD45867.1| 941|Homo sapiens gamma-aminobutyric acid... 26 8.3 AF095784-1|AAD30389.1| 941|Homo sapiens GABA-B receptor R2 prot... 26 8.3 AF074483-1|AAD03336.1| 941|Homo sapiens GABA-B receptor 2 protein. 26 8.3 AF056085-1|AAC63228.1| 941|Homo sapiens GABA-B receptor protein. 26 8.3 X16439-1|CAA34462.1| 45|Homo sapiens protein ( Human retinobla... 26 8.8 M19701-1|AAA60259.1| 53|Homo sapiens RB1 protein. 26 8.8 L41889-1|AAB59467.1| 45|Homo sapiens retinoblastoma suspectibi... 26 8.8 BC043498-1|AAH43498.1| 333|Homo sapiens mitochondrial fission r... 26 9.0 BC036116-1|AAH36116.1| 333|Homo sapiens mitochondrial fission r... 26 9.0 D13634-1|BAA02798.1| 314|Homo sapiens KIAA0009 protein. 26 9.0 CR456910-1|CAG33191.1| 314|Homo sapiens CHPPR protein. 26 9.0 BC049204-1|AAH49204.1| 251|Homo sapiens homeobox B4 protein. 31 9.1 AL137449-1|CAB70742.1| 246|Homo sapiens hypothetical protein pr... 31 9.1 AF307160-1|AAG45052.1| 251|Homo sapiens HOXB4 protein. 31 9.1 AF287967-4|AAG31554.1| 251|Homo sapiens homeobox B4 protein. 31 9.1 BX537854-1|CAD97862.1| 290|Homo sapiens hypothetical protein pr... 26 9.1 AK093350-1|BAC04142.1| 231|Homo sapiens protein ( Homo sapiens ... 26 9.3 >AB002337-1|BAA20797.2| 1709|Homo sapiens KIAA0339 protein protein. Length = 1709 Score = 39.1 bits (87), Expect = 0.034 Identities = 17/48 (35%), Positives = 17/48 (35%) Frame = -3 Query: 1283 PPPPPPPPXXXXXXXXXXXXXXGGXGXXXPPXXXXXXXXXXPPPPPPP 1140 PPPPPPPP PP PPPPPPP Sbjct: 608 PPPPPPPPPPPYLASLPLGYPPHQPAYLLPPRPDGPPPPEYPPPPPPP 655 >DQ067453-1|AAZ23040.1| 1262|Homo sapiens diaphanous-1 protein. Length = 1262 Score = 37.1 bits (82), Expect = 0.14 Identities = 18/48 (37%), Positives = 18/48 (37%) Frame = -3 Query: 1283 PPPPPPPPXXXXXXXXXXXXXXGGXGXXXPPXXXXXXXXXXPPPPPPP 1140 PPPPPPPP GG PP PPPPP P Sbjct: 603 PPPPPPPPLPGGVCISSPPSLPGGTAISPPP--PLSGDATIPPPPPLP 648 Score = 33.1 bits (72), Expect = 2.2 Identities = 18/52 (34%), Positives = 18/52 (34%), Gaps = 4/52 (7%) Frame = -2 Query: 1281 PPPPPPPPXXXXXXXXXXXXGGGGGXXXPXXXXXXXXXXXXPP----PPPPP 1138 PPPPPP P GG G P PP PPPPP Sbjct: 691 PPPPPPLPGEAGMPPPPPPLPGGPGIPPPPPFPGGPGIPPPPPGMGMPPPPP 742 Score = 32.3 bits (70), Expect = 3.9 Identities = 16/49 (32%), Positives = 16/49 (32%) Frame = -2 Query: 1284 PPPPPPPPPXXXXXXXXXXXXGGGGGXXXPXXXXXXXXXXXXPPPPPPP 1138 PPPPPPPPP G PPPPP P Sbjct: 600 PPPPPPPPPPPLPGGVCISSPPSLPGGTAISPPPPLSGDATIPPPPPLP 648 Score = 31.1 bits (67), Expect = 9.1 Identities = 16/44 (36%), Positives = 16/44 (36%) Frame = -3 Query: 1277 PPPPPPXXXXXXXXXXXXXXGGXGXXXPPXXXXXXXXXXPPPPP 1146 PPPPPP GG G PP PPPPP Sbjct: 704 PPPPPPLPGGPGIPPPPPFPGGPGIPPPP-----PGMGMPPPPP 742 >BC117257-1|AAI17258.1| 1262|Homo sapiens diaphanous homolog 1 (Drosophila) protein. Length = 1262 Score = 37.1 bits (82), Expect = 0.14 Identities = 18/48 (37%), Positives = 18/48 (37%) Frame = -3 Query: 1283 PPPPPPPPXXXXXXXXXXXXXXGGXGXXXPPXXXXXXXXXXPPPPPPP 1140 PPPPPPPP GG PP PPPPP P Sbjct: 603 PPPPPPPPLPGGVCISSPPSLPGGTAISPPP--PLSGDATIPPPPPLP 648 Score = 33.1 bits (72), Expect = 2.2 Identities = 18/52 (34%), Positives = 18/52 (34%), Gaps = 4/52 (7%) Frame = -2 Query: 1281 PPPPPPPPXXXXXXXXXXXXGGGGGXXXPXXXXXXXXXXXXPP----PPPPP 1138 PPPPPP P GG G P PP PPPPP Sbjct: 691 PPPPPPLPGEAGMPPPPPPLPGGPGIPPPPPFPGGPGIPPPPPGMGMPPPPP 742 Score = 32.3 bits (70), Expect = 3.9 Identities = 16/49 (32%), Positives = 16/49 (32%) Frame = -2 Query: 1284 PPPPPPPPPXXXXXXXXXXXXGGGGGXXXPXXXXXXXXXXXXPPPPPPP 1138 PPPPPPPPP G PPPPP P Sbjct: 600 PPPPPPPPPPPLPGGVCISSPPSLPGGTAISPPPPLSGDATIPPPPPLP 648 Score = 31.1 bits (67), Expect = 9.1 Identities = 16/44 (36%), Positives = 16/44 (36%) Frame = -3 Query: 1277 PPPPPPXXXXXXXXXXXXXXGGXGXXXPPXXXXXXXXXXPPPPP 1146 PPPPPP GG G PP PPPPP Sbjct: 704 PPPPPPLPGGPGIPPPPPFPGGPGIPPPP-----PGMGMPPPPP 742 >AY363395-1|AAQ63049.1| 1272|Homo sapiens diaphanous 1 protein. Length = 1272 Score = 37.1 bits (82), Expect = 0.14 Identities = 18/48 (37%), Positives = 18/48 (37%) Frame = -3 Query: 1283 PPPPPPPPXXXXXXXXXXXXXXGGXGXXXPPXXXXXXXXXXPPPPPPP 1140 PPPPPPPP GG PP PPPPP P Sbjct: 613 PPPPPPPPLPGGVCISSPPSLPGGTAISPPP--PLSGDATIPPPPPLP 658 Score = 33.1 bits (72), Expect = 2.2 Identities = 18/52 (34%), Positives = 18/52 (34%), Gaps = 4/52 (7%) Frame = -2 Query: 1281 PPPPPPPPXXXXXXXXXXXXGGGGGXXXPXXXXXXXXXXXXPP----PPPPP 1138 PPPPPP P GG G P PP PPPPP Sbjct: 701 PPPPPPLPGEAGMPPPPPPLPGGPGIPPPPPFPGGPGIPPPPPGMGMPPPPP 752 Score = 32.3 bits (70), Expect = 3.9 Identities = 16/49 (32%), Positives = 16/49 (32%) Frame = -2 Query: 1284 PPPPPPPPPXXXXXXXXXXXXGGGGGXXXPXXXXXXXXXXXXPPPPPPP 1138 PPPPPPPPP G PPPPP P Sbjct: 610 PPPPPPPPPPPLPGGVCISSPPSLPGGTAISPPPPLSGDATIPPPPPLP 658 Score = 31.1 bits (67), Expect = 9.1 Identities = 16/44 (36%), Positives = 16/44 (36%) Frame = -3 Query: 1277 PPPPPPXXXXXXXXXXXXXXGGXGXXXPPXXXXXXXXXXPPPPP 1146 PPPPPP GG G PP PPPPP Sbjct: 714 PPPPPPLPGGPGIPPPPPFPGGPGIPPPP-----PGMGMPPPPP 752 >AK023345-1|BAB14533.1| 533|Homo sapiens protein ( Homo sapiens cDNA FLJ13283 fis, clone OVARC1001113, highly similar to Homo sapiens diaphanous 1 (HDIA1) mRNA. ). Length = 533 Score = 37.1 bits (82), Expect = 0.14 Identities = 18/48 (37%), Positives = 18/48 (37%) Frame = -3 Query: 1283 PPPPPPPPXXXXXXXXXXXXXXGGXGXXXPPXXXXXXXXXXPPPPPPP 1140 PPPPPPPP GG PP PPPPP P Sbjct: 380 PPPPPPPPLPGGVCISSPPSLPGGTAISPPP--PLSGDATIPPPPPLP 425 Score = 32.3 bits (70), Expect = 3.9 Identities = 16/49 (32%), Positives = 16/49 (32%) Frame = -2 Query: 1284 PPPPPPPPPXXXXXXXXXXXXGGGGGXXXPXXXXXXXXXXXXPPPPPPP 1138 PPPPPPPPP G PPPPP P Sbjct: 377 PPPPPPPPPPPLPGGVCISSPPSLPGGTAISPPPPLSGDATIPPPPPLP 425 >AB209482-1|BAD92719.1| 1299|Homo sapiens Diaphanous 1 variant protein. Length = 1299 Score = 37.1 bits (82), Expect = 0.14 Identities = 18/48 (37%), Positives = 18/48 (37%) Frame = -3 Query: 1283 PPPPPPPPXXXXXXXXXXXXXXGGXGXXXPPXXXXXXXXXXPPPPPPP 1140 PPPPPPPP GG PP PPPPP P Sbjct: 640 PPPPPPPPLPGGVCISSPPSLPGGTAISPPP--PLSGDATIPPPPPLP 685 Score = 33.1 bits (72), Expect = 2.2 Identities = 18/52 (34%), Positives = 18/52 (34%), Gaps = 4/52 (7%) Frame = -2 Query: 1281 PPPPPPPPXXXXXXXXXXXXGGGGGXXXPXXXXXXXXXXXXPP----PPPPP 1138 PPPPPP P GG G P PP PPPPP Sbjct: 728 PPPPPPLPGEAGMPPPPPPLPGGPGIPPPPPFPGGPGIPPPPPGMGMPPPPP 779 Score = 32.3 bits (70), Expect = 3.9 Identities = 16/49 (32%), Positives = 16/49 (32%) Frame = -2 Query: 1284 PPPPPPPPPXXXXXXXXXXXXGGGGGXXXPXXXXXXXXXXXXPPPPPPP 1138 PPPPPPPPP G PPPPP P Sbjct: 637 PPPPPPPPPPPLPGGVCISSPPSLPGGTAISPPPPLSGDATIPPPPPLP 685 Score = 31.1 bits (67), Expect = 9.1 Identities = 16/44 (36%), Positives = 16/44 (36%) Frame = -3 Query: 1277 PPPPPPXXXXXXXXXXXXXXGGXGXXXPPXXXXXXXXXXPPPPP 1146 PPPPPP GG G PP PPPPP Sbjct: 741 PPPPPPLPGGPGIPPPPPFPGGPGIPPPP-----PGMGMPPPPP 779 >U19927-1|AAC50140.1| 502|Homo sapiens WAS protein. Length = 502 Score = 36.3 bits (80), Expect = 0.24 Identities = 18/50 (36%), Positives = 18/50 (36%), Gaps = 2/50 (4%) Frame = -3 Query: 1283 PPPPP--PPPXXXXXXXXXXXXXXGGXGXXXPPXXXXXXXXXXPPPPPPP 1140 PPP P PPP G G PP PPPPPPP Sbjct: 352 PPPTPRGPPPPGRGGPPPPPPPATGRSGPLPPPPPGAGGPPMPPPPPPPP 401 Score = 34.3 bits (75), Expect = 0.97 Identities = 18/47 (38%), Positives = 18/47 (38%) Frame = -2 Query: 1278 PPPPPPPXXXXXXXXXXXXGGGGGXXXPXXXXXXXXXXXXPPPPPPP 1138 PPPPPPP G GG P PPPPPPP Sbjct: 367 PPPPPPPATGRSGPLPPPPPGAGGPPMPPP----------PPPPPPP 403 Score = 33.9 bits (74), Expect = 1.3 Identities = 18/48 (37%), Positives = 18/48 (37%) Frame = -3 Query: 1283 PPPPPPPPXXXXXXXXXXXXXXGGXGXXXPPXXXXXXXXXXPPPPPPP 1140 PPPPPPP GG PP PPPPPPP Sbjct: 367 PPPPPPPATGRSGPLPPPPPGAGGPPMPPPP----------PPPPPPP 404 Score = 31.9 bits (69), Expect = 5.2 Identities = 17/51 (33%), Positives = 17/51 (33%), Gaps = 2/51 (3%) Frame = -2 Query: 1284 PPPPPPPPPXXXXXXXXXXXXGGGGGXXXPXXXXXXXXXXXXPPP--PPPP 1138 P PPPPPP GG G P P P PPPP Sbjct: 312 PLPPPPPPSRGGNQLPRPPIVGGNKGRSGPLPPVPLGIAPPPPTPRGPPPP 362 >U12707-1|AAA62663.1| 502|Homo sapiens Wiskott-Aldrich syndrome protein protein. Length = 502 Score = 36.3 bits (80), Expect = 0.24 Identities = 18/50 (36%), Positives = 18/50 (36%), Gaps = 2/50 (4%) Frame = -3 Query: 1283 PPPPP--PPPXXXXXXXXXXXXXXGGXGXXXPPXXXXXXXXXXPPPPPPP 1140 PPP P PPP G G PP PPPPPPP Sbjct: 352 PPPTPRGPPPPGRGGPPPPPPPATGRSGPLPPPPPGAGGPPMPPPPPPPP 401 Score = 34.3 bits (75), Expect = 0.97 Identities = 18/47 (38%), Positives = 18/47 (38%) Frame = -2 Query: 1278 PPPPPPPXXXXXXXXXXXXGGGGGXXXPXXXXXXXXXXXXPPPPPPP 1138 PPPPPPP G GG P PPPPPPP Sbjct: 367 PPPPPPPATGRSGPLPPPPPGAGGPPMPPP----------PPPPPPP 403 Score = 33.9 bits (74), Expect = 1.3 Identities = 18/48 (37%), Positives = 18/48 (37%) Frame = -3 Query: 1283 PPPPPPPPXXXXXXXXXXXXXXGGXGXXXPPXXXXXXXXXXPPPPPPP 1140 PPPPPPP GG PP PPPPPPP Sbjct: 367 PPPPPPPATGRSGPLPPPPPGAGGPPMPPPP----------PPPPPPP 404 Score = 31.9 bits (69), Expect = 5.2 Identities = 17/51 (33%), Positives = 17/51 (33%), Gaps = 2/51 (3%) Frame = -2 Query: 1284 PPPPPPPPPXXXXXXXXXXXXGGGGGXXXPXXXXXXXXXXXXPPP--PPPP 1138 P PPPPPP GG G P P P PPPP Sbjct: 312 PLPPPPPPSRGGNQLPRPPIVGGNKGRSGPLPPVPLGIAPPPPTPRGPPPP 362 >BC012738-1|AAH12738.1| 502|Homo sapiens Wiskott-Aldrich syndrome (eczema-thrombocytopenia) protein. Length = 502 Score = 36.3 bits (80), Expect = 0.24 Identities = 18/50 (36%), Positives = 18/50 (36%), Gaps = 2/50 (4%) Frame = -3 Query: 1283 PPPPP--PPPXXXXXXXXXXXXXXGGXGXXXPPXXXXXXXXXXPPPPPPP 1140 PPP P PPP G G PP PPPPPPP Sbjct: 352 PPPTPRGPPPPGRGGPPPPPPPATGRSGPLPPPPPGAGGPPMPPPPPPPP 401 Score = 34.3 bits (75), Expect = 0.97 Identities = 18/47 (38%), Positives = 18/47 (38%) Frame = -2 Query: 1278 PPPPPPPXXXXXXXXXXXXGGGGGXXXPXXXXXXXXXXXXPPPPPPP 1138 PPPPPPP G GG P PPPPPPP Sbjct: 367 PPPPPPPATGRSGPLPPPPPGAGGPPMPPP----------PPPPPPP 403 Score = 33.9 bits (74), Expect = 1.3 Identities = 18/48 (37%), Positives = 18/48 (37%) Frame = -3 Query: 1283 PPPPPPPPXXXXXXXXXXXXXXGGXGXXXPPXXXXXXXXXXPPPPPPP 1140 PPPPPPP GG PP PPPPPPP Sbjct: 367 PPPPPPPATGRSGPLPPPPPGAGGPPMPPPP----------PPPPPPP 404 Score = 31.9 bits (69), Expect = 5.2 Identities = 17/51 (33%), Positives = 17/51 (33%), Gaps = 2/51 (3%) Frame = -2 Query: 1284 PPPPPPPPPXXXXXXXXXXXXGGGGGXXXPXXXXXXXXXXXXPPP--PPPP 1138 P PPPPPP GG G P P P PPPP Sbjct: 312 PLPPPPPPSRGGNQLPRPPIVGGNKGRSGPLPPVPLGIAPPPPTPRGPPPP 362 >BC002961-1|AAH02961.1| 514|Homo sapiens WAS protein protein. Length = 514 Score = 36.3 bits (80), Expect = 0.24 Identities = 18/50 (36%), Positives = 18/50 (36%), Gaps = 2/50 (4%) Frame = -3 Query: 1283 PPPPP--PPPXXXXXXXXXXXXXXGGXGXXXPPXXXXXXXXXXPPPPPPP 1140 PPP P PPP G G PP PPPPPPP Sbjct: 364 PPPTPRGPPPPGRGGPPPPPPPATGRSGPLPPPPPGAGGPPMPPPPPPPP 413 Score = 34.3 bits (75), Expect = 0.97 Identities = 18/47 (38%), Positives = 18/47 (38%) Frame = -2 Query: 1278 PPPPPPPXXXXXXXXXXXXGGGGGXXXPXXXXXXXXXXXXPPPPPPP 1138 PPPPPPP G GG P PPPPPPP Sbjct: 379 PPPPPPPATGRSGPLPPPPPGAGGPPMPPP----------PPPPPPP 415 Score = 33.9 bits (74), Expect = 1.3 Identities = 18/48 (37%), Positives = 18/48 (37%) Frame = -3 Query: 1283 PPPPPPPPXXXXXXXXXXXXXXGGXGXXXPPXXXXXXXXXXPPPPPPP 1140 PPPPPPP GG PP PPPPPPP Sbjct: 379 PPPPPPPATGRSGPLPPPPPGAGGPPMPPPP----------PPPPPPP 416 Score = 31.9 bits (69), Expect = 5.2 Identities = 17/51 (33%), Positives = 17/51 (33%), Gaps = 2/51 (3%) Frame = -2 Query: 1284 PPPPPPPPPXXXXXXXXXXXXGGGGGXXXPXXXXXXXXXXXXPPP--PPPP 1138 P PPPPPP GG G P P P PPPP Sbjct: 324 PLPPPPPPSRGGNQLPRPPIVGGNKGRSGPLPPVPLGIAPPPPTPRGPPPP 374 >AF115549-1|AAD26691.1| 502|Homo sapiens Wiskott-Aldrich Syndrome protein protein. Length = 502 Score = 36.3 bits (80), Expect = 0.24 Identities = 18/50 (36%), Positives = 18/50 (36%), Gaps = 2/50 (4%) Frame = -3 Query: 1283 PPPPP--PPPXXXXXXXXXXXXXXGGXGXXXPPXXXXXXXXXXPPPPPPP 1140 PPP P PPP G G PP PPPPPPP Sbjct: 352 PPPTPRGPPPPGRGGPPPPPPPATGRSGPLPPPPPGAGGPPMPPPPPPPP 401 Score = 34.7 bits (76), Expect = 0.74 Identities = 18/47 (38%), Positives = 18/47 (38%) Frame = -2 Query: 1278 PPPPPPPXXXXXXXXXXXXGGGGGXXXPXXXXXXXXXXXXPPPPPPP 1138 PPPPPPP G GG P PPPPPPP Sbjct: 367 PPPPPPPATGRSGPLPPPPPGAGGPPMPPPP---------PPPPPPP 404 Score = 33.9 bits (74), Expect = 1.3 Identities = 18/48 (37%), Positives = 18/48 (37%) Frame = -3 Query: 1283 PPPPPPPPXXXXXXXXXXXXXXGGXGXXXPPXXXXXXXXXXPPPPPPP 1140 PPPPPPP GG PP PPPPPPP Sbjct: 367 PPPPPPPATGRSGPLPPPPPGAGGPPMPPPP----------PPPPPPP 404 Score = 31.9 bits (69), Expect = 5.2 Identities = 17/51 (33%), Positives = 17/51 (33%), Gaps = 2/51 (3%) Frame = -2 Query: 1284 PPPPPPPPPXXXXXXXXXXXXGGGGGXXXPXXXXXXXXXXXXPPP--PPPP 1138 P PPPPPP GG G P P P PPPP Sbjct: 312 PLPPPPPPSRGGNQLPRPPIAGGNKGRSGPLPPVPLGIAPPPPTPRGPPPP 362 >AB033031-1|BAA86519.1| 1217|Homo sapiens KIAA1205 protein protein. Length = 1217 Score = 35.9 bits (79), Expect = 0.32 Identities = 16/48 (33%), Positives = 16/48 (33%) Frame = -2 Query: 1281 PPPPPPPPXXXXXXXXXXXXGGGGGXXXPXXXXXXXXXXXXPPPPPPP 1138 PPPPPPPP P PPPPPPP Sbjct: 652 PPPPPPPPQPALPSPPPLVAPTPSSPPPPPLPPPPPPAMPSPPPPPPP 699 Score = 32.7 bits (71), Expect = 3.0 Identities = 15/48 (31%), Positives = 15/48 (31%) Frame = -2 Query: 1284 PPPPPPPPPXXXXXXXXXXXXGGGGGXXXPXXXXXXXXXXXXPPPPPP 1141 PPPPPPPP P PPPPPP Sbjct: 652 PPPPPPPPQPALPSPPPLVAPTPSSPPPPPLPPPPPPAMPSPPPPPPP 699 Score = 32.3 bits (70), Expect = 3.9 Identities = 15/49 (30%), Positives = 15/49 (30%) Frame = -2 Query: 1284 PPPPPPPPPXXXXXXXXXXXXGGGGGXXXPXXXXXXXXXXXXPPPPPPP 1138 P PPPPPPP P PPPPPP Sbjct: 650 PQPPPPPPPPQPALPSPPPLVAPTPSSPPPPPLPPPPPPAMPSPPPPPP 698 Score = 29.5 bits (63), Expect(2) = 0.77 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1284 PPPPPPPPP 1258 PPPPPPPPP Sbjct: 220 PPPPPPPPP 228 Score = 23.8 bits (49), Expect(2) = 0.77 Identities = 7/7 (100%), Positives = 7/7 (100%) Frame = -2 Query: 1158 PPPPPPP 1138 PPPPPPP Sbjct: 223 PPPPPPP 229 >BC040943-1|AAH40943.1| 498|Homo sapiens WAS protein family, member 2 protein. Length = 498 Score = 35.5 bits (78), Expect = 0.42 Identities = 18/51 (35%), Positives = 18/51 (35%), Gaps = 2/51 (3%) Frame = -2 Query: 1284 PPPPPPPPPXXXXXXXXXXXXGGGGGXXXP--XXXXXXXXXXXXPPPPPPP 1138 P PPPPPPP G G P PPPPPPP Sbjct: 320 PAPPPPPPPMIGIPPPPPPVGFGSPGTPPPPSPPSFPPHPDFAAPPPPPPP 370 Score = 31.9 bits (69), Expect = 5.2 Identities = 18/49 (36%), Positives = 18/49 (36%) Frame = -2 Query: 1284 PPPPPPPPPXXXXXXXXXXXXGGGGGXXXPXXXXXXXXXXXXPPPPPPP 1138 PPPPPPPP GG P PPPPPPP Sbjct: 364 PPPPPPPPAADYPTLPPPPLSQPTGGAPPP------------PPPPPPP 400 >AL096774-6|CAC18518.1| 498|Homo sapiens WAS protein family, member 2 protein. Length = 498 Score = 35.5 bits (78), Expect = 0.42 Identities = 18/51 (35%), Positives = 18/51 (35%), Gaps = 2/51 (3%) Frame = -2 Query: 1284 PPPPPPPPPXXXXXXXXXXXXGGGGGXXXP--XXXXXXXXXXXXPPPPPPP 1138 P PPPPPPP G G P PPPPPPP Sbjct: 320 PAPPPPPPPMIGIPPPPPPVGFGSPGTPPPPSPPSFPPHPDFAAPPPPPPP 370 Score = 31.9 bits (69), Expect = 5.2 Identities = 18/49 (36%), Positives = 18/49 (36%) Frame = -2 Query: 1284 PPPPPPPPPXXXXXXXXXXXXGGGGGXXXPXXXXXXXXXXXXPPPPPPP 1138 PPPPPPPP GG P PPPPPPP Sbjct: 364 PPPPPPPPAADYPTLPPPPLSQPTGGAPPP------------PPPPPPP 400 >AB026542-1|BAA81795.1| 498|Homo sapiens WASP-family protein protein. Length = 498 Score = 35.5 bits (78), Expect = 0.42 Identities = 18/51 (35%), Positives = 18/51 (35%), Gaps = 2/51 (3%) Frame = -2 Query: 1284 PPPPPPPPPXXXXXXXXXXXXGGGGGXXXP--XXXXXXXXXXXXPPPPPPP 1138 P PPPPPPP G G P PPPPPPP Sbjct: 320 PAPPPPPPPMIGIPPPPPPVGFGSPGTPPPPSPPSFPPHPDFAAPPPPPPP 370 Score = 31.9 bits (69), Expect = 5.2 Identities = 18/49 (36%), Positives = 18/49 (36%) Frame = -2 Query: 1284 PPPPPPPPPXXXXXXXXXXXXGGGGGXXXPXXXXXXXXXXXXPPPPPPP 1138 PPPPPPPP GG P PPPPPPP Sbjct: 364 PPPPPPPPAADYPTLPPPPLSQPTGGAPPP------------PPPPPPP 400 >AF105378-1|AAD30210.2| 456|Homo sapiens heparan sulfate 3-O-sulfotransferase-4 protein. Length = 456 Score = 29.5 bits (63), Expect(2) = 0.49 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1284 PPPPPPPPP 1258 PPPPPPPPP Sbjct: 7 PPPPPPPPP 15 Score = 24.6 bits (51), Expect(2) = 0.49 Identities = 10/28 (35%), Positives = 10/28 (35%) Frame = -2 Query: 1221 GGGGGXXXPXXXXXXXXXXXXPPPPPPP 1138 GG G P PPP PPP Sbjct: 54 GGSGSLQFPLALQESPGAAAEPPPSPPP 81 >AY476736-1|AAS58324.1| 244|Homo sapiens heparan sulfate 3-O-sulfotransferase-4 protein. Length = 244 Score = 29.5 bits (63), Expect(2) = 0.51 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1284 PPPPPPPPP 1258 PPPPPPPPP Sbjct: 7 PPPPPPPPP 15 Score = 24.6 bits (51), Expect(2) = 0.51 Identities = 10/28 (35%), Positives = 10/28 (35%) Frame = -2 Query: 1221 GGGGGXXXPXXXXXXXXXXXXPPPPPPP 1138 GG G P PPP PPP Sbjct: 54 GGSGSLQFPLALQESPGAAAEPPPSPPP 81 >AF528529-1|AAM94279.1| 502|Homo sapiens hypothetical protein protein. Length = 502 Score = 27.5 bits (58), Expect(2) = 0.63 Identities = 11/29 (37%), Positives = 11/29 (37%) Frame = -2 Query: 1281 PPPPPPPPXXXXXXXXXXXXGGGGGXXXP 1195 P PPPPPP G G G P Sbjct: 23 PQPPPPPPGPGAGPGAGGAGGAGAGAGDP 51 Score = 26.2 bits (55), Expect(2) = 0.63 Identities = 8/9 (88%), Positives = 8/9 (88%) Frame = -2 Query: 1284 PPPPPPPPP 1258 PPPP PPPP Sbjct: 9 PPPPAPPPP 17 >BC087835-1|AAH87835.1| 338|Homo sapiens FAM44A protein protein. Length = 338 Score = 27.5 bits (58), Expect(2) = 0.65 Identities = 11/29 (37%), Positives = 11/29 (37%) Frame = -2 Query: 1281 PPPPPPPPXXXXXXXXXXXXGGGGGXXXP 1195 P PPPPPP G G G P Sbjct: 23 PQPPPPPPGPGAGPGAGGAGGAGAGAGDP 51 Score = 26.2 bits (55), Expect(2) = 0.65 Identities = 8/9 (88%), Positives = 8/9 (88%) Frame = -2 Query: 1284 PPPPPPPPP 1258 PPPP PPPP Sbjct: 9 PPPPAPPPP 17 >BC065546-1|AAH65546.1| 338|Homo sapiens FAM44A protein protein. Length = 338 Score = 27.5 bits (58), Expect(2) = 0.65 Identities = 11/29 (37%), Positives = 11/29 (37%) Frame = -2 Query: 1281 PPPPPPPPXXXXXXXXXXXXGGGGGXXXP 1195 P PPPPPP G G G P Sbjct: 23 PQPPPPPPGPGAGPGAGGAGGAGAGAGDP 51 Score = 26.2 bits (55), Expect(2) = 0.65 Identities = 8/9 (88%), Positives = 8/9 (88%) Frame = -2 Query: 1284 PPPPPPPPP 1258 PPPP PPPP Sbjct: 9 PPPPAPPPP 17 >AB083343-1|BAE96598.1| 3599|Homo sapiens zinc-finger homeodomain protein 4 protein. Length = 3599 Score = 29.5 bits (63), Expect(2) = 0.72 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1284 PPPPPPPPP 1258 PPPPPPPPP Sbjct: 3146 PPPPPPPPP 3154 Score = 23.8 bits (49), Expect(2) = 0.72 Identities = 7/7 (100%), Positives = 7/7 (100%) Frame = -2 Query: 1158 PPPPPPP 1138 PPPPPPP Sbjct: 3149 PPPPPPP 3155 >AL834396-1|CAD39058.1| 1009|Homo sapiens hypothetical protein protein. Length = 1009 Score = 34.7 bits (76), Expect = 0.74 Identities = 16/47 (34%), Positives = 16/47 (34%) Frame = -3 Query: 1280 PPPPPPPXXXXXXXXXXXXXXGGXGXXXPPXXXXXXXXXXPPPPPPP 1140 P PPPPP G PP PPPPPPP Sbjct: 441 PLPPPPPPLPPSSDTPETVQNGPVTPPMPPPPPPPPPPPPPPPPPPP 487 Score = 33.9 bits (74), Expect = 1.3 Identities = 16/48 (33%), Positives = 16/48 (33%) Frame = -3 Query: 1283 PPPPPPPPXXXXXXXXXXXXXXGGXGXXXPPXXXXXXXXXXPPPPPPP 1140 P PPPPPP PP PPPPPPP Sbjct: 441 PLPPPPPPLPPSSDTPETVQNGPVTPPMPPPPPPPPPPPPPPPPPPPP 488 Score = 33.9 bits (74), Expect = 1.3 Identities = 16/48 (33%), Positives = 16/48 (33%) Frame = -3 Query: 1283 PPPPPPPPXXXXXXXXXXXXXXGGXGXXXPPXXXXXXXXXXPPPPPPP 1140 PPPPPP P PP PPPPPPP Sbjct: 443 PPPPPPLPPSSDTPETVQNGPVTPPMPPPPPPPPPPPPPPPPPPPPPP 490 >AB067489-1|BAB67795.1| 1112|Homo sapiens KIAA1902 protein protein. Length = 1112 Score = 34.7 bits (76), Expect = 0.74 Identities = 16/47 (34%), Positives = 16/47 (34%) Frame = -3 Query: 1280 PPPPPPPXXXXXXXXXXXXXXGGXGXXXPPXXXXXXXXXXPPPPPPP 1140 P PPPPP G PP PPPPPPP Sbjct: 544 PLPPPPPPLPPSSDTPETVQNGPVTPPMPPPPPPPPPPPPPPPPPPP 590 Score = 33.9 bits (74), Expect = 1.3 Identities = 16/48 (33%), Positives = 16/48 (33%) Frame = -3 Query: 1283 PPPPPPPPXXXXXXXXXXXXXXGGXGXXXPPXXXXXXXXXXPPPPPPP 1140 P PPPPPP PP PPPPPPP Sbjct: 544 PLPPPPPPLPPSSDTPETVQNGPVTPPMPPPPPPPPPPPPPPPPPPPP 591 Score = 33.9 bits (74), Expect = 1.3 Identities = 16/48 (33%), Positives = 16/48 (33%) Frame = -3 Query: 1283 PPPPPPPPXXXXXXXXXXXXXXGGXGXXXPPXXXXXXXXXXPPPPPPP 1140 PPPPPP P PP PPPPPPP Sbjct: 546 PPPPPPLPPSSDTPETVQNGPVTPPMPPPPPPPPPPPPPPPPPPPPPP 593 >AB051500-1|BAB21804.2| 1652|Homo sapiens KIAA1713 protein protein. Length = 1652 Score = 29.5 bits (63), Expect(2) = 0.76 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1284 PPPPPPPPP 1258 PPPPPPPPP Sbjct: 1424 PPPPPPPPP 1432 Score = 23.8 bits (49), Expect(2) = 0.76 Identities = 7/7 (100%), Positives = 7/7 (100%) Frame = -2 Query: 1158 PPPPPPP 1138 PPPPPPP Sbjct: 1437 PPPPPPP 1443 >AB005297-1|BAA23647.1| 1584|Homo sapiens BAI 1 protein. Length = 1584 Score = 29.5 bits (63), Expect(2) = 0.76 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1284 PPPPPPPPP 1258 PPPPPPPPP Sbjct: 1411 PPPPPPPPP 1419 Score = 23.8 bits (49), Expect(2) = 0.76 Identities = 7/7 (100%), Positives = 7/7 (100%) Frame = -2 Query: 1158 PPPPPPP 1138 PPPPPPP Sbjct: 1414 PPPPPPP 1420 >AY494951-1|AAS82582.1| 1250|Homo sapiens lamellipodin protein. Length = 1250 Score = 29.5 bits (63), Expect(2) = 0.77 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1284 PPPPPPPPP 1258 PPPPPPPPP Sbjct: 629 PPPPPPPPP 637 Score = 29.5 bits (63), Expect(2) = 0.77 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1284 PPPPPPPPP 1258 PPPPPPPPP Sbjct: 631 PPPPPPPPP 639 Score = 29.5 bits (63), Expect(2) = 0.77 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1284 PPPPPPPPP 1258 PPPPPPPPP Sbjct: 633 PPPPPPPPP 641 Score = 29.5 bits (63), Expect(2) = 0.77 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1284 PPPPPPPPP 1258 PPPPPPPPP Sbjct: 636 PPPPPPPPP 644 Score = 23.8 bits (49), Expect(2) = 0.77 Identities = 7/7 (100%), Positives = 7/7 (100%) Frame = -2 Query: 1158 PPPPPPP 1138 PPPPPPP Sbjct: 632 PPPPPPP 638 Score = 23.8 bits (49), Expect(2) = 0.77 Identities = 7/7 (100%), Positives = 7/7 (100%) Frame = -2 Query: 1158 PPPPPPP 1138 PPPPPPP Sbjct: 635 PPPPPPP 641 Score = 23.8 bits (49), Expect(2) = 0.77 Identities = 7/7 (100%), Positives = 7/7 (100%) Frame = -2 Query: 1158 PPPPPPP 1138 PPPPPPP Sbjct: 636 PPPPPPP 642 Score = 23.8 bits (49), Expect(2) = 0.77 Identities = 7/7 (100%), Positives = 7/7 (100%) Frame = -2 Query: 1158 PPPPPPP 1138 PPPPPPP Sbjct: 640 PPPPPPP 646 >AJ584699-1|CAE48361.1| 1250|Homo sapiens RAPH1 protein protein. Length = 1250 Score = 29.5 bits (63), Expect(2) = 0.77 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1284 PPPPPPPPP 1258 PPPPPPPPP Sbjct: 629 PPPPPPPPP 637 Score = 29.5 bits (63), Expect(2) = 0.77 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1284 PPPPPPPPP 1258 PPPPPPPPP Sbjct: 631 PPPPPPPPP 639 Score = 29.5 bits (63), Expect(2) = 0.77 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1284 PPPPPPPPP 1258 PPPPPPPPP Sbjct: 633 PPPPPPPPP 641 Score = 29.5 bits (63), Expect(2) = 0.77 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1284 PPPPPPPPP 1258 PPPPPPPPP Sbjct: 636 PPPPPPPPP 644 Score = 23.8 bits (49), Expect(2) = 0.77 Identities = 7/7 (100%), Positives = 7/7 (100%) Frame = -2 Query: 1158 PPPPPPP 1138 PPPPPPP Sbjct: 632 PPPPPPP 638 Score = 23.8 bits (49), Expect(2) = 0.77 Identities = 7/7 (100%), Positives = 7/7 (100%) Frame = -2 Query: 1158 PPPPPPP 1138 PPPPPPP Sbjct: 635 PPPPPPP 641 Score = 23.8 bits (49), Expect(2) = 0.77 Identities = 7/7 (100%), Positives = 7/7 (100%) Frame = -2 Query: 1158 PPPPPPP 1138 PPPPPPP Sbjct: 636 PPPPPPP 642 Score = 23.8 bits (49), Expect(2) = 0.77 Identities = 7/7 (100%), Positives = 7/7 (100%) Frame = -2 Query: 1158 PPPPPPP 1138 PPPPPPP Sbjct: 640 PPPPPPP 646 >AB051468-1|BAB21772.1| 1236|Homo sapiens KIAA1681 protein protein. Length = 1236 Score = 29.5 bits (63), Expect(2) = 0.77 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1284 PPPPPPPPP 1258 PPPPPPPPP Sbjct: 615 PPPPPPPPP 623 Score = 29.5 bits (63), Expect(2) = 0.77 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1284 PPPPPPPPP 1258 PPPPPPPPP Sbjct: 617 PPPPPPPPP 625 Score = 29.5 bits (63), Expect(2) = 0.77 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1284 PPPPPPPPP 1258 PPPPPPPPP Sbjct: 619 PPPPPPPPP 627 Score = 29.5 bits (63), Expect(2) = 0.77 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1284 PPPPPPPPP 1258 PPPPPPPPP Sbjct: 622 PPPPPPPPP 630 Score = 23.8 bits (49), Expect(2) = 0.77 Identities = 7/7 (100%), Positives = 7/7 (100%) Frame = -2 Query: 1158 PPPPPPP 1138 PPPPPPP Sbjct: 618 PPPPPPP 624 Score = 23.8 bits (49), Expect(2) = 0.77 Identities = 7/7 (100%), Positives = 7/7 (100%) Frame = -2 Query: 1158 PPPPPPP 1138 PPPPPPP Sbjct: 621 PPPPPPP 627 Score = 23.8 bits (49), Expect(2) = 0.77 Identities = 7/7 (100%), Positives = 7/7 (100%) Frame = -2 Query: 1158 PPPPPPP 1138 PPPPPPP Sbjct: 622 PPPPPPP 628 Score = 23.8 bits (49), Expect(2) = 0.77 Identities = 7/7 (100%), Positives = 7/7 (100%) Frame = -2 Query: 1158 PPPPPPP 1138 PPPPPPP Sbjct: 626 PPPPPPP 632 >AL096764-2|CAM28218.1| 1137|Homo sapiens chromosome X open reading frame 45 protein. Length = 1137 Score = 29.5 bits (63), Expect(2) = 0.78 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1284 PPPPPPPPP 1258 PPPPPPPPP Sbjct: 924 PPPPPPPPP 932 Score = 23.8 bits (49), Expect(2) = 0.78 Identities = 7/7 (100%), Positives = 7/7 (100%) Frame = -2 Query: 1158 PPPPPPP 1138 PPPPPPP Sbjct: 939 PPPPPPP 945 >AL049563-1|CAM28289.1| 1137|Homo sapiens chromosome X open reading frame 45 protein. Length = 1137 Score = 29.5 bits (63), Expect(2) = 0.78 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1284 PPPPPPPPP 1258 PPPPPPPPP Sbjct: 924 PPPPPPPPP 932 Score = 23.8 bits (49), Expect(2) = 0.78 Identities = 7/7 (100%), Positives = 7/7 (100%) Frame = -2 Query: 1158 PPPPPPP 1138 PPPPPPP Sbjct: 939 PPPPPPP 945 >BC117407-1|AAI17408.1| 1081|Homo sapiens LOC152485 protein protein. Length = 1081 Score = 29.5 bits (63), Expect(2) = 0.78 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1284 PPPPPPPPP 1258 PPPPPPPPP Sbjct: 334 PPPPPPPPP 342 Score = 23.8 bits (49), Expect(2) = 0.78 Identities = 7/7 (100%), Positives = 7/7 (100%) Frame = -2 Query: 1158 PPPPPPP 1138 PPPPPPP Sbjct: 337 PPPPPPP 343 >AK091130-1|BAC03591.1| 1077|Homo sapiens protein ( Homo sapiens cDNA FLJ33811 fis, clone CTONG2002095. ). Length = 1077 Score = 29.5 bits (63), Expect(2) = 0.78 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1284 PPPPPPPPP 1258 PPPPPPPPP Sbjct: 334 PPPPPPPPP 342 Score = 23.8 bits (49), Expect(2) = 0.78 Identities = 7/7 (100%), Positives = 7/7 (100%) Frame = -2 Query: 1158 PPPPPPP 1138 PPPPPPP Sbjct: 337 PPPPPPP 343 >AB023231-1|BAA76858.2| 1050|Homo sapiens KIAA1014 protein protein. Length = 1050 Score = 29.5 bits (63), Expect(2) = 0.78 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1284 PPPPPPPPP 1258 PPPPPPPPP Sbjct: 755 PPPPPPPPP 763 Score = 29.5 bits (63), Expect(2) = 0.78 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1284 PPPPPPPPP 1258 PPPPPPPPP Sbjct: 939 PPPPPPPPP 947 Score = 26.6 bits (56), Expect(2) = 4.9 Identities = 8/8 (100%), Positives = 8/8 (100%) Frame = -2 Query: 1281 PPPPPPPP 1258 PPPPPPPP Sbjct: 745 PPPPPPPP 752 Score = 23.8 bits (49), Expect(2) = 4.9 Identities = 7/7 (100%), Positives = 7/7 (100%) Frame = -2 Query: 1158 PPPPPPP 1138 PPPPPPP Sbjct: 756 PPPPPPP 762 Score = 23.8 bits (49), Expect(2) = 0.78 Identities = 7/7 (100%), Positives = 7/7 (100%) Frame = -2 Query: 1158 PPPPPPP 1138 PPPPPPP Sbjct: 758 PPPPPPP 764 Score = 23.8 bits (49), Expect(2) = 0.78 Identities = 7/7 (100%), Positives = 7/7 (100%) Frame = -2 Query: 1158 PPPPPPP 1138 PPPPPPP Sbjct: 943 PPPPPPP 949 >BC037404-1|AAH37404.1| 1015|Homo sapiens formin binding protein 4 protein. Length = 1015 Score = 29.5 bits (63), Expect(2) = 0.78 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1284 PPPPPPPPP 1258 PPPPPPPPP Sbjct: 720 PPPPPPPPP 728 Score = 29.5 bits (63), Expect(2) = 0.78 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1284 PPPPPPPPP 1258 PPPPPPPPP Sbjct: 904 PPPPPPPPP 912 Score = 26.6 bits (56), Expect(2) = 4.9 Identities = 8/8 (100%), Positives = 8/8 (100%) Frame = -2 Query: 1281 PPPPPPPP 1258 PPPPPPPP Sbjct: 710 PPPPPPPP 717 Score = 23.8 bits (49), Expect(2) = 4.9 Identities = 7/7 (100%), Positives = 7/7 (100%) Frame = -2 Query: 1158 PPPPPPP 1138 PPPPPPP Sbjct: 721 PPPPPPP 727 Score = 23.8 bits (49), Expect(2) = 0.78 Identities = 7/7 (100%), Positives = 7/7 (100%) Frame = -2 Query: 1158 PPPPPPP 1138 PPPPPPP Sbjct: 723 PPPPPPP 729 Score = 23.8 bits (49), Expect(2) = 0.78 Identities = 7/7 (100%), Positives = 7/7 (100%) Frame = -2 Query: 1158 PPPPPPP 1138 PPPPPPP Sbjct: 908 PPPPPPP 914 >AY827075-1|AAV87312.1| 927|Homo sapiens F-box protein 11 protein. Length = 927 Score = 29.5 bits (63), Expect(2) = 0.79 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1284 PPPPPPPPP 1258 PPPPPPPPP Sbjct: 57 PPPPPPPPP 65 Score = 23.8 bits (49), Expect(2) = 0.79 Identities = 7/7 (100%), Positives = 7/7 (100%) Frame = -2 Query: 1158 PPPPPPP 1138 PPPPPPP Sbjct: 60 PPPPPPP 66 >BC043258-1|AAH43258.2| 915|Homo sapiens FBXO11 protein protein. Length = 915 Score = 29.5 bits (63), Expect(2) = 0.79 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1284 PPPPPPPPP 1258 PPPPPPPPP Sbjct: 45 PPPPPPPPP 53 Score = 23.8 bits (49), Expect(2) = 0.79 Identities = 7/7 (100%), Positives = 7/7 (100%) Frame = -2 Query: 1158 PPPPPPP 1138 PPPPPPP Sbjct: 48 PPPPPPP 54 >BC000401-1|AAH00401.2| 894|Homo sapiens SF3B2 protein protein. Length = 894 Score = 29.5 bits (63), Expect(2) = 0.79 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1284 PPPPPPPPP 1258 PPPPPPPPP Sbjct: 103 PPPPPPPPP 111 Score = 23.8 bits (49), Expect(2) = 0.79 Identities = 7/7 (100%), Positives = 7/7 (100%) Frame = -2 Query: 1158 PPPPPPP 1138 PPPPPPP Sbjct: 106 PPPPPPP 112 >BC053577-1|AAH53577.1| 877|Homo sapiens SF3B2 protein protein. Length = 877 Score = 29.5 bits (63), Expect(2) = 0.79 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1284 PPPPPPPPP 1258 PPPPPPPPP Sbjct: 104 PPPPPPPPP 112 Score = 23.8 bits (49), Expect(2) = 0.79 Identities = 7/7 (100%), Positives = 7/7 (100%) Frame = -2 Query: 1158 PPPPPPP 1138 PPPPPPP Sbjct: 107 PPPPPPP 113 >BC052781-1|AAH52781.1| 802|Homo sapiens RANBP9 protein protein. Length = 802 Score = 29.5 bits (63), Expect(2) = 0.80 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1284 PPPPPPPPP 1258 PPPPPPPPP Sbjct: 156 PPPPPPPPP 164 Score = 23.8 bits (49), Expect(2) = 0.80 Identities = 7/7 (100%), Positives = 7/7 (100%) Frame = -2 Query: 1158 PPPPPPP 1138 PPPPPPP Sbjct: 159 PPPPPPP 165 >BX537771-1|CAD97834.1| 799|Homo sapiens hypothetical protein protein. Length = 799 Score = 29.5 bits (63), Expect(2) = 0.80 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1284 PPPPPPPPP 1258 PPPPPPPPP Sbjct: 106 PPPPPPPPP 114 Score = 23.8 bits (49), Expect(2) = 0.80 Identities = 7/7 (100%), Positives = 7/7 (100%) Frame = -2 Query: 1158 PPPPPPP 1138 PPPPPPP Sbjct: 109 PPPPPPP 115 >AK091683-1|BAC03720.1| 749|Homo sapiens protein ( Homo sapiens cDNA FLJ34364 fis, clone FEBRA2015175, weakly similar to Mus musculus (clone E5.53) Huntington disease (hdh) gene. ). Length = 749 Score = 29.5 bits (63), Expect(2) = 0.80 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1284 PPPPPPPPP 1258 PPPPPPPPP Sbjct: 658 PPPPPPPPP 666 Score = 23.8 bits (49), Expect(2) = 0.80 Identities = 7/7 (100%), Positives = 7/7 (100%) Frame = -2 Query: 1158 PPPPPPP 1138 PPPPPPP Sbjct: 671 PPPPPPP 677 >U88666-1|AAC05299.1| 686|Homo sapiens serine kinase SRPK2 protein. Length = 686 Score = 29.5 bits (63), Expect(2) = 0.80 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1284 PPPPPPPPP 1258 PPPPPPPPP Sbjct: 25 PPPPPPPPP 33 Score = 23.8 bits (49), Expect(2) = 0.80 Identities = 7/7 (100%), Positives = 7/7 (100%) Frame = -2 Query: 1158 PPPPPPP 1138 PPPPPPP Sbjct: 30 PPPPPPP 36 >BC068547-1|AAH68547.1| 688|Homo sapiens SRPK2 protein protein. Length = 688 Score = 29.5 bits (63), Expect(2) = 0.80 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1284 PPPPPPPPP 1258 PPPPPPPPP Sbjct: 25 PPPPPPPPP 33 Score = 23.8 bits (49), Expect(2) = 0.80 Identities = 7/7 (100%), Positives = 7/7 (100%) Frame = -2 Query: 1158 PPPPPPP 1138 PPPPPPP Sbjct: 30 PPPPPPP 36 >BC035214-1|AAH35214.1| 688|Homo sapiens SFRS protein kinase 2 protein. Length = 688 Score = 29.5 bits (63), Expect(2) = 0.80 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1284 PPPPPPPPP 1258 PPPPPPPPP Sbjct: 25 PPPPPPPPP 33 Score = 23.8 bits (49), Expect(2) = 0.80 Identities = 7/7 (100%), Positives = 7/7 (100%) Frame = -2 Query: 1158 PPPPPPP 1138 PPPPPPP Sbjct: 30 PPPPPPP 36 >AC005070-2|AAC29140.1| 675|Homo sapiens serine kinase SRPK2 protein. Length = 675 Score = 29.5 bits (63), Expect(2) = 0.81 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1284 PPPPPPPPP 1258 PPPPPPPPP Sbjct: 12 PPPPPPPPP 20 Score = 23.8 bits (49), Expect(2) = 0.81 Identities = 7/7 (100%), Positives = 7/7 (100%) Frame = -2 Query: 1158 PPPPPPP 1138 PPPPPPP Sbjct: 17 PPPPPPP 23 >AC005070-1|AAC29141.1| 675|Homo sapiens WUGSC:H_RG152G17.1a protein. Length = 675 Score = 29.5 bits (63), Expect(2) = 0.81 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1284 PPPPPPPPP 1258 PPPPPPPPP Sbjct: 12 PPPPPPPPP 20 Score = 23.8 bits (49), Expect(2) = 0.81 Identities = 7/7 (100%), Positives = 7/7 (100%) Frame = -2 Query: 1158 PPPPPPP 1138 PPPPPPP Sbjct: 17 PPPPPPP 23 >AY950679-1|AAY34147.1| 659|Homo sapiens MEX3C protein. Length = 659 Score = 29.5 bits (63), Expect(2) = 0.81 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1284 PPPPPPPPP 1258 PPPPPPPPP Sbjct: 21 PPPPPPPPP 29 Score = 23.8 bits (49), Expect(2) = 0.81 Identities = 7/7 (100%), Positives = 7/7 (100%) Frame = -2 Query: 1158 PPPPPPP 1138 PPPPPPP Sbjct: 24 PPPPPPP 30 >AK056450-1|BAB71186.1| 568|Homo sapiens protein ( Homo sapiens cDNA FLJ31888 fis, clone NT2RP7003055. ). Length = 568 Score = 29.5 bits (63), Expect(2) = 0.81 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1284 PPPPPPPPP 1258 PPPPPPPPP Sbjct: 340 PPPPPPPPP 348 Score = 23.8 bits (49), Expect(2) = 0.81 Identities = 7/7 (100%), Positives = 7/7 (100%) Frame = -2 Query: 1158 PPPPPPP 1138 PPPPPPP Sbjct: 353 PPPPPPP 359 >AK022987-1|BAB14348.1| 560|Homo sapiens protein ( Homo sapiens cDNA FLJ12925 fis, clone NT2RP2004710, highly similar to Mus musculus formin binding protein 30 mRNA. ). Length = 560 Score = 29.5 bits (63), Expect(2) = 0.82 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1284 PPPPPPPPP 1258 PPPPPPPPP Sbjct: 265 PPPPPPPPP 273 Score = 29.5 bits (63), Expect(2) = 0.82 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1284 PPPPPPPPP 1258 PPPPPPPPP Sbjct: 449 PPPPPPPPP 457 Score = 26.6 bits (56), Expect(2) = 5.1 Identities = 8/8 (100%), Positives = 8/8 (100%) Frame = -2 Query: 1281 PPPPPPPP 1258 PPPPPPPP Sbjct: 255 PPPPPPPP 262 Score = 23.8 bits (49), Expect(2) = 5.1 Identities = 7/7 (100%), Positives = 7/7 (100%) Frame = -2 Query: 1158 PPPPPPP 1138 PPPPPPP Sbjct: 266 PPPPPPP 272 Score = 23.8 bits (49), Expect(2) = 0.82 Identities = 7/7 (100%), Positives = 7/7 (100%) Frame = -2 Query: 1158 PPPPPPP 1138 PPPPPPP Sbjct: 268 PPPPPPP 274 Score = 23.8 bits (49), Expect(2) = 0.82 Identities = 7/7 (100%), Positives = 7/7 (100%) Frame = -2 Query: 1158 PPPPPPP 1138 PPPPPPP Sbjct: 453 PPPPPPP 459 >AY354201-1|AAQ63886.1| 546|Homo sapiens SFRS protein kinase 2 isoform c protein. Length = 546 Score = 29.5 bits (63), Expect(2) = 0.82 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1284 PPPPPPPPP 1258 PPPPPPPPP Sbjct: 25 PPPPPPPPP 33 Score = 23.8 bits (49), Expect(2) = 0.82 Identities = 7/7 (100%), Positives = 7/7 (100%) Frame = -2 Query: 1158 PPPPPPP 1138 PPPPPPP Sbjct: 30 PPPPPPP 36 >AK123671-1|BAC85674.1| 520|Homo sapiens protein ( Homo sapiens cDNA FLJ41677 fis, clone HCASM2002918. ). Length = 520 Score = 29.5 bits (63), Expect(2) = 0.82 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1284 PPPPPPPPP 1258 PPPPPPPPP Sbjct: 458 PPPPPPPPP 466 Score = 29.5 bits (63), Expect(2) = 0.82 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1284 PPPPPPPPP 1258 PPPPPPPPP Sbjct: 459 PPPPPPPPP 467 Score = 23.8 bits (49), Expect(2) = 0.82 Identities = 7/7 (100%), Positives = 7/7 (100%) Frame = -2 Query: 1158 PPPPPPP 1138 PPPPPPP Sbjct: 463 PPPPPPP 469 Score = 23.8 bits (49), Expect(2) = 0.82 Identities = 7/7 (100%), Positives = 7/7 (100%) Frame = -2 Query: 1158 PPPPPPP 1138 PPPPPPP Sbjct: 465 PPPPPPP 471 >BC044311-1|AAH44311.2| 399|Homo sapiens hypothetical protein LOC339344 protein. Length = 399 Score = 29.5 bits (63), Expect(2) = 0.83 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1284 PPPPPPPPP 1258 PPPPPPPPP Sbjct: 311 PPPPPPPPP 319 Score = 23.8 bits (49), Expect(2) = 0.83 Identities = 7/7 (100%), Positives = 7/7 (100%) Frame = -2 Query: 1158 PPPPPPP 1138 PPPPPPP Sbjct: 314 PPPPPPP 320 >AL078621-10|CAB81647.1| 232|Homo sapiens protein ( G islands. ).). Length = 232 Score = 29.5 bits (63), Expect(2) = 0.87 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1284 PPPPPPPPP 1258 PPPPPPPPP Sbjct: 161 PPPPPPPPP 169 Score = 26.2 bits (55), Expect(2) = 7.2 Identities = 8/9 (88%), Positives = 8/9 (88%) Frame = -2 Query: 1284 PPPPPPPPP 1258 PPP PPPPP Sbjct: 157 PPPSPPPPP 165 Score = 26.2 bits (55), Expect(2) = 7.2 Identities = 8/9 (88%), Positives = 8/9 (88%) Frame = -2 Query: 1284 PPPPPPPPP 1258 P PPPPPPP Sbjct: 159 PSPPPPPPP 167 Score = 23.8 bits (49), Expect(2) = 7.2 Identities = 7/7 (100%), Positives = 7/7 (100%) Frame = -2 Query: 1158 PPPPPPP 1138 PPPPPPP Sbjct: 162 PPPPPPP 168 Score = 23.8 bits (49), Expect(2) = 7.2 Identities = 7/7 (100%), Positives = 7/7 (100%) Frame = -2 Query: 1158 PPPPPPP 1138 PPPPPPP Sbjct: 163 PPPPPPP 169 Score = 23.8 bits (49), Expect(2) = 0.87 Identities = 7/7 (100%), Positives = 7/7 (100%) Frame = -2 Query: 1158 PPPPPPP 1138 PPPPPPP Sbjct: 175 PPPPPPP 181 >AF174599-1|AAF04520.1| 197|Homo sapiens F-box protein Fbx11 protein. Length = 197 Score = 29.5 bits (63), Expect(2) = 0.88 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1284 PPPPPPPPP 1258 PPPPPPPPP Sbjct: 42 PPPPPPPPP 50 Score = 23.8 bits (49), Expect(2) = 0.88 Identities = 7/7 (100%), Positives = 7/7 (100%) Frame = -2 Query: 1158 PPPPPPP 1138 PPPPPPP Sbjct: 45 PPPPPPP 51 >AF176706-1|AAF17611.1| 192|Homo sapiens F-box protein FBX11 protein. Length = 192 Score = 29.5 bits (63), Expect(2) = 0.89 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1284 PPPPPPPPP 1258 PPPPPPPPP Sbjct: 38 PPPPPPPPP 46 Score = 23.8 bits (49), Expect(2) = 0.89 Identities = 7/7 (100%), Positives = 7/7 (100%) Frame = -2 Query: 1158 PPPPPPP 1138 PPPPPPP Sbjct: 41 PPPPPPP 47 >AY225516-1|AAO74853.1| 153|Homo sapiens acetylcholinesterase membrane anchor precursor PRiMA variant I protein. Length = 153 Score = 29.5 bits (63), Expect(2) = 0.91 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1284 PPPPPPPPP 1258 PPPPPPPPP Sbjct: 61 PPPPPPPPP 69 Score = 23.8 bits (49), Expect(2) = 0.91 Identities = 7/7 (100%), Positives = 7/7 (100%) Frame = -2 Query: 1158 PPPPPPP 1138 PPPPPPP Sbjct: 64 PPPPPPP 70 >AY225517-1|AAO74854.1| 124|Homo sapiens acetylcholinesterase membrane anchor precursor PRiMA variant II protein. Length = 124 Score = 29.5 bits (63), Expect(2) = 0.94 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 1284 PPPPPPPPP 1258 PPPPPPPPP Sbjct: 61 PPPPPPPPP 69 Score = 23.8 bits (49), Expect(2) = 0.94 Identities = 7/7 (100%), Positives = 7/7 (100%) Frame = -2 Query: 1158 PPPPPPP 1138 PPPPPPP Sbjct: 64 PPPPPPP 70 >AL355338-1|CAH70366.2| 663|Homo sapiens Zic family member 5 (odd-paired homolog, Drosophila) protein. Length = 663 Score = 34.3 bits (75), Expect = 0.97 Identities = 13/25 (52%), Positives = 13/25 (52%) Frame = -2 Query: 1284 PPPPPPPPPXXXXXXXXXXXXGGGG 1210 PPPPPPPPP GGGG Sbjct: 163 PPPPPPPPPPPALSGYTTTNSGGGG 187 Score = 31.9 bits (69), Expect = 5.2 Identities = 12/26 (46%), Positives = 12/26 (46%) Frame = -2 Query: 1284 PPPPPPPPPXXXXXXXXXXXXGGGGG 1207 PPPPPPPPP GG G Sbjct: 165 PPPPPPPPPALSGYTTTNSGGGGSSG 190 Score = 31.5 bits (68), Expect = 6.9 Identities = 12/25 (48%), Positives = 12/25 (48%) Frame = -2 Query: 1281 PPPPPPPPXXXXXXXXXXXXGGGGG 1207 PPPPPPPP GGGG Sbjct: 163 PPPPPPPPPPPALSGYTTTNSGGGG 187 >AF378304-1|AAK55418.1| 639|Homo sapiens zinc family member 5 protein protein. Length = 639 Score = 34.3 bits (75), Expect = 0.97 Identities = 13/25 (52%), Positives = 13/25 (52%) Frame = -2 Query: 1284 PPPPPPPPPXXXXXXXXXXXXGGGG 1210 PPPPPPPPP GGGG Sbjct: 139 PPPPPPPPPPPALSGYTTTNSGGGG 163 Score = 31.9 bits (69), Expect = 5.2 Identities = 12/26 (46%), Positives = 12/26 (46%) Frame = -2 Query: 1284 PPPPPPPPPXXXXXXXXXXXXGGGGG 1207 PPPPPPPPP GG G Sbjct: 141 PPPPPPPPPALSGYTTTNSGGGGSSG 166 Score = 31.5 bits (68), Expect = 6.9 Identities = 12/25 (48%), Positives = 12/25 (48%) Frame = -2 Query: 1281 PPPPPPPPXXXXXXXXXXXXGGGGG 1207 PPPPPPPP GGGG Sbjct: 139 PPPPPPPPPPPALSGYTTTNSGGGG 163 >D88460-1|BAA20128.1| 505|Homo sapiens N-WASP protein. Length = 505 Score = 33.9 bits (74), Expect = 1.3 Identities = 15/45 (33%), Positives = 15/45 (33%) Frame = -3 Query: 1274 PPPPPXXXXXXXXXXXXXXGGXGXXXPPXXXXXXXXXXPPPPPPP 1140 PPPPP G PP PPPPPPP Sbjct: 335 PPPPPNRMYPPPPPALPSSAPSGPPPPPPSVLGVGPVAPPPPPPP 379 Score = 33.1 bits (72), Expect = 2.2 Identities = 17/48 (35%), Positives = 17/48 (35%) Frame = -3 Query: 1283 PPPPPPPPXXXXXXXXXXXXXXGGXGXXXPPXXXXXXXXXXPPPPPPP 1140 PPPPPPPP G G PP PPPP P Sbjct: 287 PPPPPPPPHSSGPPPPPAR----GRGAPPPPPSRAPTAAPPPPPPSRP 330 Score = 31.1 bits (67), Expect = 9.1 Identities = 17/56 (30%), Positives = 17/56 (30%), Gaps = 7/56 (12%) Frame = -2 Query: 1284 PPPP-------PPPPPXXXXXXXXXXXXGGGGGXXXPXXXXXXXXXXXXPPPPPPP 1138 PPPP PPPPP P PPPPPPP Sbjct: 324 PPPPSRPSVEVPPPPPNRMYPPPPPALPSSAPSGPPPPPPSVLGVGPVAPPPPPPP 379 Score = 31.1 bits (67), Expect = 9.1 Identities = 15/46 (32%), Positives = 15/46 (32%) Frame = -3 Query: 1283 PPPPPPPPXXXXXXXXXXXXXXGGXGXXXPPXXXXXXXXXXPPPPP 1146 PPPPP P G G PP PPPPP Sbjct: 344 PPPPPALPSSAPSGPPPPPPSVLGVGPVAPPPPPPPPPPPGPPPPP 389 >BC052955-1|AAH52955.1| 505|Homo sapiens Wiskott-Aldrich syndrome-like protein. Length = 505 Score = 33.9 bits (74), Expect = 1.3 Identities = 15/45 (33%), Positives = 15/45 (33%) Frame = -3 Query: 1274 PPPPPXXXXXXXXXXXXXXGGXGXXXPPXXXXXXXXXXPPPPPPP 1140 PPPPP G PP PPPPPPP Sbjct: 335 PPPPPNRMYPPPPPALPSSAPSGPPPPPPSVLGVGPVAPPPPPPP 379 Score = 33.1 bits (72), Expect = 2.2 Identities = 17/48 (35%), Positives = 17/48 (35%) Frame = -3 Query: 1283 PPPPPPPPXXXXXXXXXXXXXXGGXGXXXPPXXXXXXXXXXPPPPPPP 1140 PPPPPPPP G G PP PPPP P Sbjct: 287 PPPPPPPPHNSGPPPPPAR----GRGAPPPPPSRAPTAAPPPPPPSRP 330 Score = 31.1 bits (67), Expect = 9.1 Identities = 17/56 (30%), Positives = 17/56 (30%), Gaps = 7/56 (12%) Frame = -2 Query: 1284 PPPP-------PPPPPXXXXXXXXXXXXGGGGGXXXPXXXXXXXXXXXXPPPPPPP 1138 PPPP PPPPP P PPPPPPP Sbjct: 324 PPPPSRPSVAVPPPPPNRMYPPPPPALPSSAPSGPPPPPPSVLGVGPVAPPPPPPP 379 Score = 31.1 bits (67), Expect = 9.1 Identities = 15/46 (32%), Positives = 15/46 (32%) Frame = -3 Query: 1283 PPPPPPPPXXXXXXXXXXXXXXGGXGXXXPPXXXXXXXXXXPPPPP 1146 PPPPP P G G PP PPPPP Sbjct: 344 PPPPPALPSSAPSGPPPPPPSVLGVGPVAPPPPPPPPPPPGPPPPP 389 >AM295156-1|CAL26602.1| 505|Homo sapiens WASL protein protein. Length = 505 Score = 33.9 bits (74), Expect = 1.3 Identities = 15/45 (33%), Positives = 15/45 (33%) Frame = -3 Query: 1274 PPPPPXXXXXXXXXXXXXXGGXGXXXPPXXXXXXXXXXPPPPPPP 1140 PPPPP G PP PPPPPPP Sbjct: 335 PPPPPNRMYPPPPPALLSSAPSGPPPPPPSVLGVGPVAPPPPPPP 379 Score = 33.1 bits (72), Expect = 2.2 Identities = 17/48 (35%), Positives = 17/48 (35%) Frame = -3 Query: 1283 PPPPPPPPXXXXXXXXXXXXXXGGXGXXXPPXXXXXXXXXXPPPPPPP 1140 PPPPPPPP G G PP PPPP P Sbjct: 287 PPPPPPPPHNSGPPPPPAR----GRGAPPPPPSRAPTAAPPPPPPSRP 330 Score = 31.1 bits (67), Expect = 9.1 Identities = 17/56 (30%), Positives = 17/56 (30%), Gaps = 7/56 (12%) Frame = -2 Query: 1284 PPPP-------PPPPPXXXXXXXXXXXXGGGGGXXXPXXXXXXXXXXXXPPPPPPP 1138 PPPP PPPPP P PPPPPPP Sbjct: 324 PPPPSRPSVAVPPPPPNRMYPPPPPALLSSAPSGPPPPPPSVLGVGPVAPPPPPPP 379 >AC006333-1|AAQ96857.1| 505|Homo sapiens unknown protein. Length = 505 Score = 33.9 bits (74), Expect = 1.3 Identities = 15/45 (33%), Positives = 15/45 (33%) Frame = -3 Query: 1274 PPPPPXXXXXXXXXXXXXXGGXGXXXPPXXXXXXXXXXPPPPPPP 1140 PPPPP G PP PPPPPPP Sbjct: 335 PPPPPNRMYPPPPPALPSSAPSGPPPPPPSVLGVGPVAPPPPPPP 379 Score = 33.1 bits (72), Expect = 2.2 Identities = 17/48 (35%), Positives = 17/48 (35%) Frame = -3 Query: 1283 PPPPPPPPXXXXXXXXXXXXXXGGXGXXXPPXXXXXXXXXXPPPPPPP 1140 PPPPPPPP G G PP PPPP P Sbjct: 287 PPPPPPPPHNSGPPPPPAR----GRGAPPPPPSRAPTAAPPPPPPSRP 330 Score = 31.1 bits (67), Expect = 9.1 Identities = 17/56 (30%), Positives = 17/56 (30%), Gaps = 7/56 (12%) Frame = -2 Query: 1284 PPPP-------PPPPPXXXXXXXXXXXXGGGGGXXXPXXXXXXXXXXXXPPPPPPP 1138 PPPP PPPPP P PPPPPPP Sbjct: 324 PPPPSRPSVAVPPPPPNRMYPPPPPALPSSAPSGPPPPPPSVLGVGPVAPPPPPPP 379 Score = 31.1 bits (67), Expect = 9.1 Identities = 15/46 (32%), Positives = 15/46 (32%) Frame = -3 Query: 1283 PPPPPPPPXXXXXXXXXXXXXXGGXGXXXPPXXXXXXXXXXPPPPP 1146 PPPPP P G G PP PPPPP Sbjct: 344 PPPPPALPSSAPSGPPPPPPSVLGVGPVAPPPPPPPPPPPGPPPPP 389 >BC038446-1|AAH38446.1| 673|Homo sapiens SF1 protein protein. Length = 673 Score = 33.5 bits (73), Expect = 1.7 Identities = 17/51 (33%), Positives = 17/51 (33%), Gaps = 2/51 (3%) Frame = -2 Query: 1284 PPPPPPPPPXXXXXXXXXXXXGGGGGXXXP--XXXXXXXXXXXXPPPPPPP 1138 PPPPPPPPP G P PP PPPP Sbjct: 69 PPPPPPPPPPPPQQPPPPPPPPSPGASYPPPQPPPPPPLYQRVSPPQPPPP 119 Score = 32.3 bits (70), Expect = 3.9 Identities = 17/52 (32%), Positives = 17/52 (32%), Gaps = 4/52 (7%) Frame = -3 Query: 1283 PPPPPPPPXXXXXXXXXXXXXXGGX----GXXXPPXXXXXXXXXXPPPPPPP 1140 PPPPPPPP G PP PPPP PP Sbjct: 71 PPPPPPPPPPQQPPPPPPPPSPGASYPPPQPPPPPPLYQRVSPPQPPPPQPP 122 >DQ067452-1|AAZ23039.1| 229|Homo sapiens diaphanous-1 protein. Length = 229 Score = 33.1 bits (72), Expect = 2.2 Identities = 18/52 (34%), Positives = 18/52 (34%), Gaps = 4/52 (7%) Frame = -2 Query: 1281 PPPPPPPPXXXXXXXXXXXXGGGGGXXXPXXXXXXXXXXXXPP----PPPPP 1138 PPPPPP P GG G P PP PPPPP Sbjct: 85 PPPPPPLPGEAGMPPPPPPLPGGPGIPPPPPFPGGPGIPPPPPGMGMPPPPP 136 Score = 31.1 bits (67), Expect = 9.1 Identities = 16/44 (36%), Positives = 16/44 (36%) Frame = -3 Query: 1277 PPPPPPXXXXXXXXXXXXXXGGXGXXXPPXXXXXXXXXXPPPPP 1146 PPPPPP GG G PP PPPPP Sbjct: 98 PPPPPPLPGGPGIPPPPPFPGGPGIPPPP-----PGMGMPPPPP 136 >AY360322-1|AAQ64023.1| 179|Homo sapiens diaphanous 1 protein. Length = 179 Score = 33.1 bits (72), Expect = 2.2 Identities = 18/52 (34%), Positives = 18/52 (34%), Gaps = 4/52 (7%) Frame = -2 Query: 1281 PPPPPPPPXXXXXXXXXXXXGGGGGXXXPXXXXXXXXXXXXPP----PPPPP 1138 PPPPPP P GG G P PP PPPPP Sbjct: 85 PPPPPPLPGEAGMPPPPPPLPGGPGIPPPPPFPGGPGIPPPPPGMGMPPPPP 136 Score = 31.1 bits (67), Expect = 9.1 Identities = 16/44 (36%), Positives = 16/44 (36%) Frame = -3 Query: 1277 PPPPPPXXXXXXXXXXXXXXGGXGXXXPPXXXXXXXXXXPPPPP 1146 PPPPPP GG G PP PPPPP Sbjct: 98 PPPPPPLPGGPGIPPPPPFPGGPGIPPPP-----PGMGMPPPPP 136 >AY260762-1|AAP20225.1| 3567|Homo sapiens zinc finger homeodomain 4 protein protein. Length = 3567 Score = 33.1 bits (72), Expect = 2.2 Identities = 17/49 (34%), Positives = 17/49 (34%) Frame = -2 Query: 1284 PPPPPPPPPXXXXXXXXXXXXGGGGGXXXPXXXXXXXXXXXXPPPPPPP 1138 PPPPPPPPP G P PPPPPP Sbjct: 1958 PPPPPPPPP----LPPAPPQPSSMGPVKIPNTVSTPLQAPPPTPPPPPP 2002 Score = 33.1 bits (72), Expect = 2.2 Identities = 16/49 (32%), Positives = 16/49 (32%) Frame = -2 Query: 1284 PPPPPPPPPXXXXXXXXXXXXGGGGGXXXPXXXXXXXXXXXXPPPPPPP 1138 PPPPPPP P P PPPPPPP Sbjct: 1960 PPPPPPPLPPAPPQPSSMGPVKIPNTVSTPLQAPPPTPPPPPPPPPPPP 2008 Score = 31.5 bits (68), Expect = 6.9 Identities = 17/52 (32%), Positives = 17/52 (32%), Gaps = 4/52 (7%) Frame = -3 Query: 1283 PPPPPP----PPXXXXXXXXXXXXXXGGXGXXXPPXXXXXXXXXXPPPPPPP 1140 PPPPPP PP PP PPPPPPP Sbjct: 1961 PPPPPPLPPAPPQPSSMGPVKIPNTVSTPLQAPPPTPPPPPPPPPPPPPPPP 2012 >AF051782-1|AAC05373.1| 1248|Homo sapiens diaphanous 1 protein. Length = 1248 Score = 33.1 bits (72), Expect = 2.2 Identities = 18/52 (34%), Positives = 18/52 (34%), Gaps = 4/52 (7%) Frame = -2 Query: 1281 PPPPPPPPXXXXXXXXXXXXGGGGGXXXPXXXXXXXXXXXXPP----PPPPP 1138 PPPPPP P GG G P PP PPPPP Sbjct: 680 PPPPPPLPGEAGMPPPPPPLPGGPGIPPPPPFPGGPGIPPPPPGMGMPPPPP 731 Score = 31.1 bits (67), Expect = 9.1 Identities = 16/44 (36%), Positives = 16/44 (36%) Frame = -3 Query: 1277 PPPPPPXXXXXXXXXXXXXXGGXGXXXPPXXXXXXXXXXPPPPP 1146 PPPPPP GG G PP PPPPP Sbjct: 693 PPPPPPLPGGPGIPPPPPFPGGPGIPPPP-----PGMGMPPPPP 731 >Z86061-3|CAI42258.1| 1096|Homo sapiens diaphanous homolog 2 (Drosophila) protein. Length = 1096 Score = 32.7 bits (71), Expect = 3.0 Identities = 18/49 (36%), Positives = 18/49 (36%) Frame = -2 Query: 1284 PPPPPPPPPXXXXXXXXXXXXGGGGGXXXPXXXXXXXXXXXXPPPPPPP 1138 PPPPPP PP GG P PPPPPPP Sbjct: 562 PPPPPPAPPLP-------------GGAPLPPPPPPLPGMMGIPPPPPPP 597 Score = 31.9 bits (69), Expect = 5.2 Identities = 16/47 (34%), Positives = 16/47 (34%) Frame = -3 Query: 1283 PPPPPPPPXXXXXXXXXXXXXXGGXGXXXPPXXXXXXXXXXPPPPPP 1143 PPPPP PP G PP PPPPPP Sbjct: 563 PPPPPAPPLPGGAPLPPPPPPLPGM-MGIPPPPPPPLLFGGPPPPPP 608 Score = 31.5 bits (68), Expect = 6.9 Identities = 15/47 (31%), Positives = 15/47 (31%) Frame = -3 Query: 1283 PPPPPPPPXXXXXXXXXXXXXXGGXGXXXPPXXXXXXXXXXPPPPPP 1143 PP PP P GG PP PPPPPP Sbjct: 551 PPAAPPLPGVGPPPPPPAPPLPGGAPLPPPPPPLPGMMGIPPPPPPP 597 >Z86061-2|CAI42257.1| 1101|Homo sapiens diaphanous homolog 2 (Drosophila) protein. Length = 1101 Score = 32.7 bits (71), Expect = 3.0 Identities = 18/49 (36%), Positives = 18/49 (36%) Frame = -2 Query: 1284 PPPPPPPPPXXXXXXXXXXXXGGGGGXXXPXXXXXXXXXXXXPPPPPPP 1138 PPPPPP PP GG P PPPPPPP Sbjct: 562 PPPPPPAPPLP-------------GGAPLPPPPPPLPGMMGIPPPPPPP 597 Score = 31.9 bits (69), Expect = 5.2 Identities = 16/47 (34%), Positives = 16/47 (34%) Frame = -3 Query: 1283 PPPPPPPPXXXXXXXXXXXXXXGGXGXXXPPXXXXXXXXXXPPPPPP 1143 PPPPP PP G PP PPPPPP Sbjct: 563 PPPPPAPPLPGGAPLPPPPPPLPGM-MGIPPPPPPPLLFGGPPPPPP 608 Score = 31.5 bits (68), Expect = 6.9 Identities = 15/47 (31%), Positives = 15/47 (31%) Frame = -3 Query: 1283 PPPPPPPPXXXXXXXXXXXXXXGGXGXXXPPXXXXXXXXXXPPPPPP 1143 PP PP P GG PP PPPPPP Sbjct: 551 PPAAPPLPGVGPPPPPPAPPLPGGAPLPPPPPPLPGMMGIPPPPPPP 597 >Y15909-1|CAA75870.1| 1101|Homo sapiens DIA-156 protein protein. Length = 1101 Score = 32.7 bits (71), Expect = 3.0 Identities = 18/49 (36%), Positives = 18/49 (36%) Frame = -2 Query: 1284 PPPPPPPPPXXXXXXXXXXXXGGGGGXXXPXXXXXXXXXXXXPPPPPPP 1138 PPPPPP PP GG P PPPPPPP Sbjct: 562 PPPPPPAPPLP-------------GGAPLPPPPPPLPGMMGIPPPPPPP 597 Score = 31.9 bits (69), Expect = 5.2 Identities = 16/47 (34%), Positives = 16/47 (34%) Frame = -3 Query: 1283 PPPPPPPPXXXXXXXXXXXXXXGGXGXXXPPXXXXXXXXXXPPPPPP 1143 PPPPP PP G PP PPPPPP Sbjct: 563 PPPPPAPPLPGGAPLPPPPPPLPGM-MGIPPPPPPPLLFGGPPPPPP 608 Score = 31.5 bits (68), Expect = 6.9 Identities = 15/47 (31%), Positives = 15/47 (31%) Frame = -3 Query: 1283 PPPPPPPPXXXXXXXXXXXXXXGGXGXXXPPXXXXXXXXXXPPPPPP 1143 PP PP P GG PP PPPPPP Sbjct: 551 PPAAPPLPGVGPPPPPPAPPLPGGAPLPPPPPPLPGMMGIPPPPPPP 597 >Y15908-1|CAA75869.1| 1096|Homo sapiens DIA-12C protein protein. Length = 1096 Score = 32.7 bits (71), Expect = 3.0 Identities = 18/49 (36%), Positives = 18/49 (36%) Frame = -2 Query: 1284 PPPPPPPPPXXXXXXXXXXXXGGGGGXXXPXXXXXXXXXXXXPPPPPPP 1138 PPPPPP PP GG P PPPPPPP Sbjct: 562 PPPPPPAPPLP-------------GGAPLPPPPPPLPGMMGIPPPPPPP 597 Score = 31.9 bits (69), Expect = 5.2 Identities = 16/47 (34%), Positives = 16/47 (34%) Frame = -3 Query: 1283 PPPPPPPPXXXXXXXXXXXXXXGGXGXXXPPXXXXXXXXXXPPPPPP 1143 PPPPP PP G PP PPPPPP Sbjct: 563 PPPPPAPPLPGGAPLPPPPPPLPGM-MGIPPPPPPPLLFGGPPPPPP 608 Score = 31.5 bits (68), Expect = 6.9 Identities = 15/47 (31%), Positives = 15/47 (31%) Frame = -3 Query: 1283 PPPPPPPPXXXXXXXXXXXXXXGGXGXXXPPXXXXXXXXXXPPPPPP 1143 PP PP P GG PP PPPPPP Sbjct: 551 PPAAPPLPGVGPPPPPPAPPLPGGAPLPPPPPPLPGMMGIPPPPPPP 597 >BC117414-1|AAI17415.1| 1103|Homo sapiens DIAPH2 protein protein. Length = 1103 Score = 32.7 bits (71), Expect = 3.0 Identities = 18/49 (36%), Positives = 18/49 (36%) Frame = -2 Query: 1284 PPPPPPPPPXXXXXXXXXXXXGGGGGXXXPXXXXXXXXXXXXPPPPPPP 1138 PPPPPP PP GG P PPPPPPP Sbjct: 569 PPPPPPAPPLP-------------GGAPLPPPPPPLPGMMGIPPPPPPP 604 Score = 31.9 bits (69), Expect = 5.2 Identities = 16/47 (34%), Positives = 16/47 (34%) Frame = -3 Query: 1283 PPPPPPPPXXXXXXXXXXXXXXGGXGXXXPPXXXXXXXXXXPPPPPP 1143 PPPPP PP G PP PPPPPP Sbjct: 570 PPPPPAPPLPGGAPLPPPPPPLPGM-MGIPPPPPPPLLFGGPPPPPP 615 Score = 31.5 bits (68), Expect = 6.9 Identities = 15/47 (31%), Positives = 15/47 (31%) Frame = -3 Query: 1283 PPPPPPPPXXXXXXXXXXXXXXGGXGXXXPPXXXXXXXXXXPPPPPP 1143 PP PP P GG PP PPPPPP Sbjct: 558 PPAAPPLPGVGPPPPPPAPPLPGGAPLPPPPPPLPGMMGIPPPPPPP 604 >BC034003-1|AAH34003.1| 600|Homo sapiens PRR12 protein protein. Length = 600 Score = 32.7 bits (71), Expect = 3.0 Identities = 15/48 (31%), Positives = 15/48 (31%) Frame = -2 Query: 1284 PPPPPPPPPXXXXXXXXXXXXGGGGGXXXPXXXXXXXXXXXXPPPPPP 1141 PPPPPPPP P PPPPPP Sbjct: 107 PPPPPPPPQPALPSPPPLVAPTPSSPPPPPLPPPPPPAMPSPPPPPPP 154 Score = 32.3 bits (70), Expect = 3.9 Identities = 15/49 (30%), Positives = 15/49 (30%) Frame = -2 Query: 1284 PPPPPPPPPXXXXXXXXXXXXGGGGGXXXPXXXXXXXXXXXXPPPPPPP 1138 P PPPPPPP P PPPPPP Sbjct: 105 PQPPPPPPPPQPALPSPPPLVAPTPSSPPPPPLPPPPPPAMPSPPPPPP 153 >AL669876-2|CAH71114.1| 1096|Homo sapiens diaphanous homolog 2 (Drosophila) protein. Length = 1096 Score = 32.7 bits (71), Expect = 3.0 Identities = 18/49 (36%), Positives = 18/49 (36%) Frame = -2 Query: 1284 PPPPPPPPPXXXXXXXXXXXXGGGGGXXXPXXXXXXXXXXXXPPPPPPP 1138 PPPPPP PP GG P PPPPPPP Sbjct: 562 PPPPPPAPPLP-------------GGAPLPPPPPPLPGMMGIPPPPPPP 597 Score = 31.9 bits (69), Expect = 5.2 Identities = 16/47 (34%), Positives = 16/47 (34%) Frame = -3 Query: 1283 PPPPPPPPXXXXXXXXXXXXXXGGXGXXXPPXXXXXXXXXXPPPPPP 1143 PPPPP PP G PP PPPPPP Sbjct: 563 PPPPPAPPLPGGAPLPPPPPPLPGM-MGIPPPPPPPLLFGGPPPPPP 608 Score = 31.5 bits (68), Expect = 6.9 Identities = 15/47 (31%), Positives = 15/47 (31%) Frame = -3 Query: 1283 PPPPPPPPXXXXXXXXXXXXXXGGXGXXXPPXXXXXXXXXXPPPPPP 1143 PP PP P GG PP PPPPPP Sbjct: 551 PPAAPPLPGVGPPPPPPAPPLPGGAPLPPPPPPLPGMMGIPPPPPPP 597 >AL669876-1|CAH71113.1| 1101|Homo sapiens diaphanous homolog 2 (Drosophila) protein. Length = 1101 Score = 32.7 bits (71), Expect = 3.0 Identities = 18/49 (36%), Positives = 18/49 (36%) Frame = -2 Query: 1284 PPPPPPPPPXXXXXXXXXXXXGGGGGXXXPXXXXXXXXXXXXPPPPPPP 1138 PPPPPP PP GG P PPPPPPP Sbjct: 562 PPPPPPAPPLP-------------GGAPLPPPPPPLPGMMGIPPPPPPP 597 Score = 31.9 bits (69), Expect = 5.2 Identities = 16/47 (34%), Positives = 16/47 (34%) Frame = -3 Query: 1283 PPPPPPPPXXXXXXXXXXXXXXGGXGXXXPPXXXXXXXXXXPPPPPP 1143 PPPPP PP G PP PPPPPP Sbjct: 563 PPPPPAPPLPGGAPLPPPPPPLPGM-MGIPPPPPPPLLFGGPPPPPP 608 Score = 31.5 bits (68), Expect = 6.9 Identities = 15/47 (31%), Positives = 15/47 (31%) Frame = -3 Query: 1283 PPPPPPPPXXXXXXXXXXXXXXGGXGXXXPPXXXXXXXXXXPPPPPP 1143 PP PP P GG PP PPPPPP Sbjct: 551 PPAAPPLPGVGPPPPPPAPPLPGGAPLPPPPPPLPGMMGIPPPPPPP 597 >AL606530-3|CAI39842.1| 1096|Homo sapiens diaphanous homolog 2 (Drosophila) protein. Length = 1096 Score = 32.7 bits (71), Expect = 3.0 Identities = 18/49 (36%), Positives = 18/49 (36%) Frame = -2 Query: 1284 PPPPPPPPPXXXXXXXXXXXXGGGGGXXXPXXXXXXXXXXXXPPPPPPP 1138 PPPPPP PP GG P PPPPPPP Sbjct: 562 PPPPPPAPPLP-------------GGAPLPPPPPPLPGMMGIPPPPPPP 597 Score = 31.9 bits (69), Expect = 5.2 Identities = 16/47 (34%), Positives = 16/47 (34%) Frame = -3 Query: 1283 PPPPPPPPXXXXXXXXXXXXXXGGXGXXXPPXXXXXXXXXXPPPPPP 1143 PPPPP PP G PP PPPPPP Sbjct: 563 PPPPPAPPLPGGAPLPPPPPPLPGM-MGIPPPPPPPLLFGGPPPPPP 608 Score = 31.5 bits (68), Expect = 6.9 Identities = 15/47 (31%), Positives = 15/47 (31%) Frame = -3 Query: 1283 PPPPPPPPXXXXXXXXXXXXXXGGXGXXXPPXXXXXXXXXXPPPPPP 1143 PP PP P GG PP PPPPPP Sbjct: 551 PPAAPPLPGVGPPPPPPAPPLPGGAPLPPPPPPLPGMMGIPPPPPPP 597 >AL606530-2|CAI39841.1| 1101|Homo sapiens diaphanous homolog 2 (Drosophila) protein. Length = 1101 Score = 32.7 bits (71), Expect = 3.0 Identities = 18/49 (36%), Positives = 18/49 (36%) Frame = -2 Query: 1284 PPPPPPPPPXXXXXXXXXXXXGGGGGXXXPXXXXXXXXXXXXPPPPPPP 1138 PPPPPP PP GG P PPPPPPP Sbjct: 562 PPPPPPAPPLP-------------GGAPLPPPPPPLPGMMGIPPPPPPP 597 Score = 31.9 bits (69), Expect = 5.2 Identities = 16/47 (34%), Positives = 16/47 (34%) Frame = -3 Query: 1283 PPPPPPPPXXXXXXXXXXXXXXGGXGXXXPPXXXXXXXXXXPPPPPP 1143 PPPPP PP G PP PPPPPP Sbjct: 563 PPPPPAPPLPGGAPLPPPPPPLPGM-MGIPPPPPPPLLFGGPPPPPP 608 Score = 31.5 bits (68), Expect = 6.9 Identities = 15/47 (31%), Positives = 15/47 (31%) Frame = -3 Query: 1283 PPPPPPPPXXXXXXXXXXXXXXGGXGXXXPPXXXXXXXXXXPPPPPP 1143 PP PP P GG PP PPPPPP Sbjct: 551 PPAAPPLPGVGPPPPPPAPPLPGGAPLPPPPPPLPGMMGIPPPPPPP 597 >AL592157-3|CAI40545.1| 1096|Homo sapiens diaphanous homolog 2 (Drosophila) protein. Length = 1096 Score = 32.7 bits (71), Expect = 3.0 Identities = 18/49 (36%), Positives = 18/49 (36%) Frame = -2 Query: 1284 PPPPPPPPPXXXXXXXXXXXXGGGGGXXXPXXXXXXXXXXXXPPPPPPP 1138 PPPPPP PP GG P PPPPPPP Sbjct: 562 PPPPPPAPPLP-------------GGAPLPPPPPPLPGMMGIPPPPPPP 597 Score = 31.9 bits (69), Expect = 5.2 Identities = 16/47 (34%), Positives = 16/47 (34%) Frame = -3 Query: 1283 PPPPPPPPXXXXXXXXXXXXXXGGXGXXXPPXXXXXXXXXXPPPPPP 1143 PPPPP PP G PP PPPPPP Sbjct: 563 PPPPPAPPLPGGAPLPPPPPPLPGM-MGIPPPPPPPLLFGGPPPPPP 608 Score = 31.5 bits (68), Expect = 6.9 Identities = 15/47 (31%), Positives = 15/47 (31%) Frame = -3 Query: 1283 PPPPPPPPXXXXXXXXXXXXXXGGXGXXXPPXXXXXXXXXXPPPPPP 1143 PP PP P GG PP PPPPPP Sbjct: 551 PPAAPPLPGVGPPPPPPAPPLPGGAPLPPPPPPLPGMMGIPPPPPPP 597 >AL592157-2|CAI40544.1| 1101|Homo sapiens diaphanous homolog 2 (Drosophila) protein. Length = 1101 Score = 32.7 bits (71), Expect = 3.0 Identities = 18/49 (36%), Positives = 18/49 (36%) Frame = -2 Query: 1284 PPPPPPPPPXXXXXXXXXXXXGGGGGXXXPXXXXXXXXXXXXPPPPPPP 1138 PPPPPP PP GG P PPPPPPP Sbjct: 562 PPPPPPAPPLP-------------GGAPLPPPPPPLPGMMGIPPPPPPP 597 Score = 31.9 bits (69), Expect = 5.2 Identities = 16/47 (34%), Positives = 16/47 (34%) Frame = -3 Query: 1283 PPPPPPPPXXXXXXXXXXXXXXGGXGXXXPPXXXXXXXXXXPPPPPP 1143 PPPPP PP G PP PPPPPP Sbjct: 563 PPPPPAPPLPGGAPLPPPPPPLPGM-MGIPPPPPPPLLFGGPPPPPP 608 Score = 31.5 bits (68), Expect = 6.9 Identities = 15/47 (31%), Positives = 15/47 (31%) Frame = -3 Query: 1283 PPPPPPPPXXXXXXXXXXXXXXGGXGXXXPPXXXXXXXXXXPPPPPP 1143 PP PP P GG PP PPPPPP Sbjct: 551 PPAAPPLPGVGPPPPPPAPPLPGGAPLPPPPPPLPGMMGIPPPPPPP 597 >AL391821-1|CAH71361.1| 1101|Homo sapiens diaphanous homolog 2 (Drosophila) protein. Length = 1101 Score = 32.7 bits (71), Expect = 3.0 Identities = 18/49 (36%), Positives = 18/49 (36%) Frame = -2 Query: 1284 PPPPPPPPPXXXXXXXXXXXXGGGGGXXXPXXXXXXXXXXXXPPPPPPP 1138 PPPPPP PP GG P PPPPPPP Sbjct: 562 PPPPPPAPPLP-------------GGAPLPPPPPPLPGMMGIPPPPPPP 597 Score = 31.9 bits (69), Expect = 5.2 Identities = 16/47 (34%), Positives = 16/47 (34%) Frame = -3 Query: 1283 PPPPPPPPXXXXXXXXXXXXXXGGXGXXXPPXXXXXXXXXXPPPPPP 1143 PPPPP PP G PP PPPPPP Sbjct: 563 PPPPPAPPLPGGAPLPPPPPPLPGM-MGIPPPPPPPLLFGGPPPPPP 608 Score = 31.5 bits (68), Expect = 6.9 Identities = 15/47 (31%), Positives = 15/47 (31%) Frame = -3 Query: 1283 PPPPPPPPXXXXXXXXXXXXXXGGXGXXXPPXXXXXXXXXXPPPPPP 1143 PP PP P GG PP PPPPPP Sbjct: 551 PPAAPPLPGVGPPPPPPAPPLPGGAPLPPPPPPLPGMMGIPPPPPPP 597 >AL161624-2|CAI40916.1| 1096|Homo sapiens diaphanous homolog 2 (Drosophila) protein. Length = 1096 Score = 32.7 bits (71), Expect = 3.0 Identities = 18/49 (36%), Positives = 18/49 (36%) Frame = -2 Query: 1284 PPPPPPPPPXXXXXXXXXXXXGGGGGXXXPXXXXXXXXXXXXPPPPPPP 1138 PPPPPP PP GG P PPPPPPP Sbjct: 562 PPPPPPAPPLP-------------GGAPLPPPPPPLPGMMGIPPPPPPP 597 Score = 31.9 bits (69), Expect = 5.2 Identities = 16/47 (34%), Positives = 16/47 (34%) Frame = -3 Query: 1283 PPPPPPPPXXXXXXXXXXXXXXGGXGXXXPPXXXXXXXXXXPPPPPP 1143 PPPPP PP G PP PPPPPP Sbjct: 563 PPPPPAPPLPGGAPLPPPPPPLPGM-MGIPPPPPPPLLFGGPPPPPP 608 Score = 31.5 bits (68), Expect = 6.9 Identities = 15/47 (31%), Positives = 15/47 (31%) Frame = -3 Query: 1283 PPPPPPPPXXXXXXXXXXXXXXGGXGXXXPPXXXXXXXXXXPPPPPP 1143 PP PP P GG PP PPPPPP Sbjct: 551 PPAAPPLPGVGPPPPPPAPPLPGGAPLPPPPPPLPGMMGIPPPPPPP 597 >AL161624-1|CAI40915.1| 1101|Homo sapiens diaphanous homolog 2 (Drosophila) protein. Length = 1101 Score = 32.7 bits (71), Expect = 3.0 Identities = 18/49 (36%), Positives = 18/49 (36%) Frame = -2 Query: 1284 PPPPPPPPPXXXXXXXXXXXXGGGGGXXXPXXXXXXXXXXXXPPPPPPP 1138 PPPPPP PP GG P PPPPPPP Sbjct: 562 PPPPPPAPPLP-------------GGAPLPPPPPPLPGMMGIPPPPPPP 597 Score = 31.9 bits (69), Expect = 5.2 Identities = 16/47 (34%), Positives = 16/47 (34%) Frame = -3 Query: 1283 PPPPPPPPXXXXXXXXXXXXXXGGXGXXXPPXXXXXXXXXXPPPPPP 1143 PPPPP PP G PP PPPPPP Sbjct: 563 PPPPPAPPLPGGAPLPPPPPPLPGM-MGIPPPPPPPLLFGGPPPPPP 608 Score = 31.5 bits (68), Expect = 6.9 Identities = 15/47 (31%), Positives = 15/47 (31%) Frame = -3 Query: 1283 PPPPPPPPXXXXXXXXXXXXXXGGXGXXXPPXXXXXXXXXXPPPPPP 1143 PP PP P GG PP PPPPPP Sbjct: 551 PPAAPPLPGVGPPPPPPAPPLPGGAPLPPPPPPLPGMMGIPPPPPPP 597 >AL139809-2|CAD13477.2| 1096|Homo sapiens diaphanous homolog 2 (Drosophila) protein. Length = 1096 Score = 32.7 bits (71), Expect = 3.0 Identities = 18/49 (36%), Positives = 18/49 (36%) Frame = -2 Query: 1284 PPPPPPPPPXXXXXXXXXXXXGGGGGXXXPXXXXXXXXXXXXPPPPPPP 1138 PPPPPP PP GG P PPPPPPP Sbjct: 562 PPPPPPAPPLP-------------GGAPLPPPPPPLPGMMGIPPPPPPP 597 Score = 31.9 bits (69), Expect = 5.2 Identities = 16/47 (34%), Positives = 16/47 (34%) Frame = -3 Query: 1283 PPPPPPPPXXXXXXXXXXXXXXGGXGXXXPPXXXXXXXXXXPPPPPP 1143 PPPPP PP G PP PPPPPP Sbjct: 563 PPPPPAPPLPGGAPLPPPPPPLPGM-MGIPPPPPPPLLFGGPPPPPP 608 Score = 31.5 bits (68), Expect = 6.9 Identities = 15/47 (31%), Positives = 15/47 (31%) Frame = -3 Query: 1283 PPPPPPPPXXXXXXXXXXXXXXGGXGXXXPPXXXXXXXXXXPPPPPP 1143 PP PP P GG PP PPPPPP Sbjct: 551 PPAAPPLPGVGPPPPPPAPPLPGGAPLPPPPPPLPGMMGIPPPPPPP 597 >AL139809-1|CAI39928.1| 1101|Homo sapiens diaphanous homolog 2 (Drosophila) protein. Length = 1101 Score = 32.7 bits (71), Expect = 3.0 Identities = 18/49 (36%), Positives = 18/49 (36%) Frame = -2 Query: 1284 PPPPPPPPPXXXXXXXXXXXXGGGGGXXXPXXXXXXXXXXXXPPPPPPP 1138 PPPPPP PP GG P PPPPPPP Sbjct: 562 PPPPPPAPPLP-------------GGAPLPPPPPPLPGMMGIPPPPPPP 597 Score = 31.9 bits (69), Expect = 5.2 Identities = 16/47 (34%), Positives = 16/47 (34%) Frame = -3 Query: 1283 PPPPPPPPXXXXXXXXXXXXXXGGXGXXXPPXXXXXXXXXXPPPPPP 1143 PPPPP PP G PP PPPPPP Sbjct: 563 PPPPPAPPLPGGAPLPPPPPPLPGM-MGIPPPPPPPLLFGGPPPPPP 608 Score = 31.5 bits (68), Expect = 6.9 Identities = 15/47 (31%), Positives = 15/47 (31%) Frame = -3 Query: 1283 PPPPPPPPXXXXXXXXXXXXXXGGXGXXXPPXXXXXXXXXXPPPPPP 1143 PP PP P GG PP PPPPPP Sbjct: 551 PPAAPPLPGVGPPPPPPAPPLPGGAPLPPPPPPLPGMMGIPPPPPPP 597 >AL031053-2|CAB39108.2| 1096|Homo sapiens diaphanous homolog 2 (Drosophila) protein. Length = 1096 Score = 32.7 bits (71), Expect = 3.0 Identities = 18/49 (36%), Positives = 18/49 (36%) Frame = -2 Query: 1284 PPPPPPPPPXXXXXXXXXXXXGGGGGXXXPXXXXXXXXXXXXPPPPPPP 1138 PPPPPP PP GG P PPPPPPP Sbjct: 562 PPPPPPAPPLP-------------GGAPLPPPPPPLPGMMGIPPPPPPP 597 Score = 31.9 bits (69), Expect = 5.2 Identities = 16/47 (34%), Positives = 16/47 (34%) Frame = -3 Query: 1283 PPPPPPPPXXXXXXXXXXXXXXGGXGXXXPPXXXXXXXXXXPPPPPP 1143 PPPPP PP G PP PPPPPP Sbjct: 563 PPPPPAPPLPGGAPLPPPPPPLPGM-MGIPPPPPPPLLFGGPPPPPP 608 Score = 31.5 bits (68), Expect = 6.9 Identities = 15/47 (31%), Positives = 15/47 (31%) Frame = -3 Query: 1283 PPPPPPPPXXXXXXXXXXXXXXGGXGXXXPPXXXXXXXXXXPPPPPP 1143 PP PP P GG PP PPPPPP Sbjct: 551 PPAAPPLPGVGPPPPPPAPPLPGGAPLPPPPPPLPGMMGIPPPPPPP 597 >AL031053-1|CAI42515.1| 1101|Homo sapiens diaphanous homolog 2 (Drosophila) protein. Length = 1101 Score = 32.7 bits (71), Expect = 3.0 Identities = 18/49 (36%), Positives = 18/49 (36%) Frame = -2 Query: 1284 PPPPPPPPPXXXXXXXXXXXXGGGGGXXXPXXXXXXXXXXXXPPPPPPP 1138 PPPPPP PP GG P PPPPPPP Sbjct: 562 PPPPPPAPPLP-------------GGAPLPPPPPPLPGMMGIPPPPPPP 597 Score = 31.9 bits (69), Expect = 5.2 Identities = 16/47 (34%), Positives = 16/47 (34%) Frame = -3 Query: 1283 PPPPPPPPXXXXXXXXXXXXXXGGXGXXXPPXXXXXXXXXXPPPPPP 1143 PPPPP PP G PP PPPPPP Sbjct: 563 PPPPPAPPLPGGAPLPPPPPPLPGM-MGIPPPPPPPLLFGGPPPPPP 608 Score = 31.5 bits (68), Expect = 6.9 Identities = 15/47 (31%), Positives = 15/47 (31%) Frame = -3 Query: 1283 PPPPPPPPXXXXXXXXXXXXXXGGXGXXXPPXXXXXXXXXXPPPPPP 1143 PP PP P GG PP PPPPPP Sbjct: 551 PPAAPPLPGVGPPPPPPAPPLPGGAPLPPPPPPLPGMMGIPPPPPPP 597 >BC073988-1|AAH73988.1| 682|Homo sapiens FMNL1 protein protein. Length = 682 Score = 32.3 bits (70), Expect = 3.9 Identities = 17/51 (33%), Positives = 17/51 (33%), Gaps = 3/51 (5%) Frame = -3 Query: 1283 PPPPPPPPXXXXXXXXXXXXXXGGX---GXXXPPXXXXXXXXXXPPPPPPP 1140 PPPPPP P G PP PPPPPPP Sbjct: 124 PPPPPPLPGLPSPQEAPPSAPPQAPPLPGSPEPPPAPPLPGDLPPPPPPPP 174 >BC054516-1|AAH54516.1| 666|Homo sapiens amyloid beta (A4) precursor protein-binding, family B, member 1 interacting pro protein. Length = 666 Score = 32.3 bits (70), Expect = 3.9 Identities = 17/51 (33%), Positives = 17/51 (33%), Gaps = 3/51 (5%) Frame = -3 Query: 1283 PPPPPPPP---XXXXXXXXXXXXXXGGXGXXXPPXXXXXXXXXXPPPPPPP 1140 PPPPPPPP PP PPPPPPP Sbjct: 555 PPPPPPPPLDDPELPPPPPDFMEPPPDFVPPPPPSYAGIAGSELPPPPPPP 605 >AY278319-1|AAP32476.1| 1100|Homo sapiens leukocyte formin protein. Length = 1100 Score = 32.3 bits (70), Expect = 3.9 Identities = 17/51 (33%), Positives = 17/51 (33%), Gaps = 3/51 (5%) Frame = -3 Query: 1283 PPPPPPPPXXXXXXXXXXXXXXGGX---GXXXPPXXXXXXXXXXPPPPPPP 1140 PPPPPP P G PP PPPPPPP Sbjct: 542 PPPPPPLPGLPSPQEAPPSAPPQAPPLPGSPEPPPAPPLPGDLPPPPPPPP 592 >AY152730-1|AAN75525.1| 665|Homo sapiens Rap1-interacting adaptor molecule protein. Length = 665 Score = 32.3 bits (70), Expect = 3.9 Identities = 17/51 (33%), Positives = 17/51 (33%), Gaps = 3/51 (5%) Frame = -3 Query: 1283 PPPPPPPP---XXXXXXXXXXXXXXGGXGXXXPPXXXXXXXXXXPPPPPPP 1140 PPPPPPPP PP PPPPPPP Sbjct: 555 PPPPPPPPLDDPELPPPPPDFMEPPPDFVPPPPPSYAGIAGSELPPPPPPP 605 >AL160287-2|CAH70339.1| 666|Homo sapiens amyloid beta (A4) precursor protein-binding, family B, member 1 interacting pro protein. Length = 666 Score = 32.3 bits (70), Expect = 3.9 Identities = 17/51 (33%), Positives = 17/51 (33%), Gaps = 3/51 (5%) Frame = -3 Query: 1283 PPPPPPPP---XXXXXXXXXXXXXXGGXGXXXPPXXXXXXXXXXPPPPPPP 1140 PPPPPPPP PP PPPPPPP Sbjct: 555 PPPPPPPPLDDPELPPPPPDFMEPPPDFVPPPPPSYAGIAGSELPPPPPPP 605 >AF432213-1|AAL99920.1| 991|Homo sapiens CLL-associated antigen KW-13 protein. Length = 991 Score = 32.3 bits (70), Expect = 3.9 Identities = 17/51 (33%), Positives = 17/51 (33%), Gaps = 3/51 (5%) Frame = -3 Query: 1283 PPPPPPPPXXXXXXXXXXXXXXGGX---GXXXPPXXXXXXXXXXPPPPPPP 1140 PPPPPP P G PP PPPPPPP Sbjct: 433 PPPPPPLPGLPSPQEAPPSAPPQAPPLPGSPEPPPAPPLPGDLPPPPPPPP 483 >AB085852-1|BAC41256.1| 666|Homo sapiens proline-rich protein 73 protein. Length = 666 Score = 32.3 bits (70), Expect = 3.9 Identities = 17/51 (33%), Positives = 17/51 (33%), Gaps = 3/51 (5%) Frame = -3 Query: 1283 PPPPPPPP---XXXXXXXXXXXXXXGGXGXXXPPXXXXXXXXXXPPPPPPP 1140 PPPPPPPP PP PPPPPPP Sbjct: 555 PPPPPPPPLDDPELPPPPPDFMEPPPDFVPPPPPSYAGIAGSELPPPPPPP 605 >AB058759-1|BAB47485.1| 1134|Homo sapiens KIAA1856 protein protein. Length = 1134 Score = 31.9 bits (69), Expect = 5.2 Identities = 16/47 (34%), Positives = 16/47 (34%) Frame = -3 Query: 1283 PPPPPPPPXXXXXXXXXXXXXXGGXGXXXPPXXXXXXXXXXPPPPPP 1143 PPPPPPPP PP PPPPPP Sbjct: 955 PPPPPPPPPHPPLPPPPLPPPP--LPLRLPPLPPPPLPRPHPPPPPP 999 >X66188-1|CAA46956.1| 421|Homo sapiens proacrosin protein. Length = 421 Score = 26.6 bits (56), Expect(2) = 5.2 Identities = 8/8 (100%), Positives = 8/8 (100%) Frame = -2 Query: 1284 PPPPPPPP 1261 PPPPPPPP Sbjct: 350 PPPPPPPP 357 Score = 26.2 bits (55), Expect(2) = 6.8 Identities = 8/9 (88%), Positives = 8/9 (88%) Frame = -2 Query: 1284 PPPPPPPPP 1258 PPPPP PPP Sbjct: 344 PPPPPSPPP 352 Score = 26.2 bits (55), Expect(2) = 6.8 Identities = 8/9 (88%), Positives = 8/9 (88%) Frame = -2 Query: 1284 PPPPPPPPP 1258 PPPP PPPP Sbjct: 345 PPPPSPPPP 353 Score = 23.8 bits (49), Expect(2) = 6.8 Identities = 7/7 (100%), Positives = 7/7 (100%) Frame = -2 Query: 1158 PPPPPPP 1138 PPPPPPP Sbjct: 350 PPPPPPP 356 Score = 23.8 bits (49), Expect(2) = 6.8 Identities = 7/7 (100%), Positives = 7/7 (100%) Frame = -2 Query: 1158 PPPPPPP 1138 PPPPPPP Sbjct: 351 PPPPPPP 357 Score = 23.8 bits (49), Expect(2) = 5.2 Identities = 7/7 (100%), Positives = 7/7 (100%) Frame = -2 Query: 1158 PPPPPPP 1138 PPPPPPP Sbjct: 363 PPPPPPP 369 >X54017-1|CAA37964.1| 421|Homo sapiens preproacrosin protein. Length = 421 Score = 26.6 bits (56), Expect(2) = 5.2 Identities = 8/8 (100%), Positives = 8/8 (100%) Frame = -2 Query: 1284 PPPPPPPP 1261 PPPPPPPP Sbjct: 350 PPPPPPPP 357 Score = 26.2 bits (55), Expect(2) = 6.8 Identities = 8/9 (88%), Positives = 8/9 (88%) Frame = -2 Query: 1284 PPPPPPPPP 1258 PPPPP PPP Sbjct: 344 PPPPPSPPP 352 Score = 26.2 bits (55), Expect(2) = 6.8 Identities = 8/9 (88%), Positives = 8/9 (88%) Frame = -2 Query: 1284 PPPPPPPPP 1258 PPPP PPPP Sbjct: 345 PPPPSPPPP 353 Score = 23.8 bits (49), Expect(2) = 6.8 Identities = 7/7 (100%), Positives = 7/7 (100%) Frame = -2 Query: 1158 PPPPPPP 1138 PPPPPPP Sbjct: 350 PPPPPPP 356 Score = 23.8 bits (49), Expect(2) = 6.8 Identities = 7/7 (100%), Positives = 7/7 (100%) Frame = -2 Query: 1158 PPPPPPP 1138 PPPPPPP Sbjct: 351 PPPPPPP 357 Score = 23.8 bits (49), Expect(2) = 5.2 Identities = 7/7 (100%), Positives = 7/7 (100%) Frame = -2 Query: 1158 PPPPPPP 1138 PPPPPPP Sbjct: 363 PPPPPPP 369 >M77381-1|AAA51575.1| 184|Homo sapiens acrosin protein. Length = 184 Score = 26.6 bits (56), Expect(2) = 5.6 Identities = 8/8 (100%), Positives = 8/8 (100%) Frame = -2 Query: 1284 PPPPPPPP 1261 PPPPPPPP Sbjct: 113 PPPPPPPP 120 Score = 26.2 bits (55), Expect(2) = 7.3 Identities = 8/9 (88%), Positives = 8/9 (88%) Frame = -2 Query: 1284 PPPPPPPPP 1258 PPPPP PPP Sbjct: 107 PPPPPSPPP 115 Score = 26.2 bits (55), Expect(2) = 7.3 Identities = 8/9 (88%), Positives = 8/9 (88%) Frame = -2 Query: 1284 PPPPPPPPP 1258 PPPP PPPP Sbjct: 108 PPPPSPPPP 116 Score = 23.8 bits (49), Expect(2) = 7.3 Identities = 7/7 (100%), Positives = 7/7 (100%) Frame = -2 Query: 1158 PPPPPPP 1138 PPPPPPP Sbjct: 113 PPPPPPP 119 Score = 23.8 bits (49), Expect(2) = 7.3 Identities = 7/7 (100%), Positives = 7/7 (100%) Frame = -2 Query: 1158 PPPPPPP 1138 PPPPPPP Sbjct: 114 PPPPPPP 120 Score = 23.8 bits (49), Expect(2) = 5.6 Identities = 7/7 (100%), Positives = 7/7 (100%) Frame = -2 Query: 1158 PPPPPPP 1138 PPPPPPP Sbjct: 126 PPPPPPP 132 >AB067470-1|BAB67776.1| 1480|Homo sapiens KIAA1883 protein protein. Length = 1480 Score = 26.2 bits (55), Expect(2) = 6.2 Identities = 8/9 (88%), Positives = 8/9 (88%) Frame = -2 Query: 1284 PPPPPPPPP 1258 PP PPPPPP Sbjct: 770 PPAPPPPPP 778 Score = 23.8 bits (49), Expect(2) = 6.2 Identities = 7/7 (100%), Positives = 7/7 (100%) Frame = -2 Query: 1158 PPPPPPP 1138 PPPPPPP Sbjct: 773 PPPPPPP 779 >AK024444-1|BAB15734.1| 1343|Homo sapiens FLJ00034 protein protein. Length = 1343 Score = 26.2 bits (55), Expect(2) = 6.2 Identities = 8/9 (88%), Positives = 8/9 (88%) Frame = -2 Query: 1284 PPPPPPPPP 1258 P PPPPPPP Sbjct: 237 PSPPPPPPP 245 Score = 23.8 bits (49), Expect(2) = 6.2 Identities = 7/7 (100%), Positives = 7/7 (100%) Frame = -2 Query: 1158 PPPPPPP 1138 PPPPPPP Sbjct: 240 PPPPPPP 246 >BC053992-1|AAH53992.1| 1312|Homo sapiens SR-related CTD-associated factor 1 protein. Length = 1312 Score = 26.2 bits (55), Expect(2) = 6.2 Identities = 8/9 (88%), Positives = 8/9 (88%) Frame = -2 Query: 1284 PPPPPPPPP 1258 P PPPPPPP Sbjct: 206 PSPPPPPPP 214 Score = 23.8 bits (49), Expect(2) = 6.2 Identities = 7/7 (100%), Positives = 7/7 (100%) Frame = -2 Query: 1158 PPPPPPP 1138 PPPPPPP Sbjct: 209 PPPPPPP 215 >AF254411-1|AAF87552.1| 1312|Homo sapiens ser/arg-rich pre-mRNA splicing factor SR-A1 protein. Length = 1312 Score = 26.2 bits (55), Expect(2) = 6.2 Identities = 8/9 (88%), Positives = 8/9 (88%) Frame = -2 Query: 1284 PPPPPPPPP 1258 P PPPPPPP Sbjct: 206 PSPPPPPPP 214 Score = 23.8 bits (49), Expect(2) = 6.2 Identities = 7/7 (100%), Positives = 7/7 (100%) Frame = -2 Query: 1158 PPPPPPP 1138 PPPPPPP Sbjct: 209 PPPPPPP 215 >AB208788-1|BAD92025.1| 960|Homo sapiens Retinoblastoma-associated protein variant protein. Length = 960 Score = 26.2 bits (55), Expect(2) = 6.4 Identities = 8/9 (88%), Positives = 8/9 (88%) Frame = -2 Query: 1284 PPPPPPPPP 1258 PP PPPPPP Sbjct: 52 PPAPPPPPP 60 Score = 23.8 bits (49), Expect(2) = 6.4 Identities = 7/7 (100%), Positives = 7/7 (100%) Frame = -2 Query: 1158 PPPPPPP 1138 PPPPPPP Sbjct: 55 PPPPPPP 61 >M33647-1|AAA69806.1| 928|Homo sapiens RB1 protein. Length = 928 Score = 26.2 bits (55), Expect(2) = 6.4 Identities = 8/9 (88%), Positives = 8/9 (88%) Frame = -2 Query: 1284 PPPPPPPPP 1258 PP PPPPPP Sbjct: 20 PPAPPPPPP 28 Score = 23.8 bits (49), Expect(2) = 6.4 Identities = 7/7 (100%), Positives = 7/7 (100%) Frame = -2 Query: 1158 PPPPPPP 1138 PPPPPPP Sbjct: 23 PPPPPPP 29 >M28419-1|AAA69808.1| 928|Homo sapiens MIC2 protein. Length = 928 Score = 26.2 bits (55), Expect(2) = 6.4 Identities = 8/9 (88%), Positives = 8/9 (88%) Frame = -2 Query: 1284 PPPPPPPPP 1258 PP PPPPPP Sbjct: 20 PPAPPPPPP 28 Score = 23.8 bits (49), Expect(2) = 6.4 Identities = 7/7 (100%), Positives = 7/7 (100%) Frame = -2 Query: 1158 PPPPPPP 1138 PPPPPPP Sbjct: 23 PPPPPPP 29 >M27866-1|AAA53484.1| 928|Homo sapiens retinoblastoma susceptibility protein protein. Length = 928 Score = 26.2 bits (55), Expect(2) = 6.4 Identities = 8/9 (88%), Positives = 8/9 (88%) Frame = -2 Query: 1284 PPPPPPPPP 1258 PP PPPPPP Sbjct: 20 PPAPPPPPP 28 Score = 23.8 bits (49), Expect(2) = 6.4 Identities = 7/7 (100%), Positives = 7/7 (100%) Frame = -2 Query: 1158 PPPPPPP 1138 PPPPPPP Sbjct: 23 PPPPPPP 29 >M15400-1|AAA69807.1| 928|Homo sapiens RB1 protein. Length = 928 Score = 26.2 bits (55), Expect(2) = 6.4 Identities = 8/9 (88%), Positives = 8/9 (88%) Frame = -2 Query: 1284 PPPPPPPPP 1258 PP PPPPPP Sbjct: 20 PPAPPPPPP 28 Score = 23.8 bits (49), Expect(2) = 6.4 Identities = 7/7 (100%), Positives = 7/7 (100%) Frame = -2 Query: 1158 PPPPPPP 1138 PPPPPPP Sbjct: 23 PPPPPPP 29 >L41870-1|AAB59465.1| 928|Homo sapiens retinoblastoma suspectibility protein protein. Length = 928 Score = 26.2 bits (55), Expect(2) = 6.4 Identities = 8/9 (88%), Positives = 8/9 (88%) Frame = -2 Query: 1284 PPPPPPPPP 1258 PP PPPPPP Sbjct: 20 PPAPPPPPP 28 Score = 23.8 bits (49), Expect(2) = 6.4 Identities = 7/7 (100%), Positives = 7/7 (100%) Frame = -2 Query: 1158 PPPPPPP 1138 PPPPPPP Sbjct: 23 PPPPPPP 29 >L11910-1|AAA53483.1| 928|Homo sapiens retinoblastoma susceptibility protein protein. Length = 928 Score = 26.2 bits (55), Expect(2) = 6.4 Identities = 8/9 (88%), Positives = 8/9 (88%) Frame = -2 Query: 1284 PPPPPPPPP 1258 PP PPPPPP Sbjct: 20 PPAPPPPPP 28 Score = 23.8 bits (49), Expect(2) = 6.4 Identities = 7/7 (100%), Positives = 7/7 (100%) Frame = -2 Query: 1158 PPPPPPP 1138 PPPPPPP Sbjct: 23 PPPPPPP 29 >BC040540-1|AAH40540.1| 928|Homo sapiens retinoblastoma 1 (including osteosarcoma) protein. Length = 928 Score = 26.2 bits (55), Expect(2) = 6.4 Identities = 8/9 (88%), Positives = 8/9 (88%) Frame = -2 Query: 1284 PPPPPPPPP 1258 PP PPPPPP Sbjct: 20 PPAPPPPPP 28 Score = 23.8 bits (49), Expect(2) = 6.4 Identities = 7/7 (100%), Positives = 7/7 (100%) Frame = -2 Query: 1158 PPPPPPP 1138 PPPPPPP Sbjct: 23 PPPPPPP 29 >BC039060-1|AAH39060.1| 928|Homo sapiens retinoblastoma 1 (including osteosarcoma) protein. Length = 928 Score = 26.2 bits (55), Expect(2) = 6.4 Identities = 8/9 (88%), Positives = 8/9 (88%) Frame = -2 Query: 1284 PPPPPPPPP 1258 PP PPPPPP Sbjct: 20 PPAPPPPPP 28 Score = 23.8 bits (49), Expect(2) = 6.4 Identities = 7/7 (100%), Positives = 7/7 (100%) Frame = -2 Query: 1158 PPPPPPP 1138 PPPPPPP Sbjct: 23 PPPPPPP 29 >AL392048-1|CAH72243.1| 928|Homo sapiens retinoblastoma 1 (including osteosarcoma) protein. Length = 928 Score = 26.2 bits (55), Expect(2) = 6.4 Identities = 8/9 (88%), Positives = 8/9 (88%) Frame = -2 Query: 1284 PPPPPPPPP 1258 PP PPPPPP Sbjct: 20 PPAPPPPPP 28 Score = 23.8 bits (49), Expect(2) = 6.4 Identities = 7/7 (100%), Positives = 7/7 (100%) Frame = -2 Query: 1158 PPPPPPP 1138 PPPPPPP Sbjct: 23 PPPPPPP 29 >AL136960-1|CAH70901.1| 928|Homo sapiens retinoblastoma 1 (including osteosarcoma) protein. Length = 928 Score = 26.2 bits (55), Expect(2) = 6.4 Identities = 8/9 (88%), Positives = 8/9 (88%) Frame = -2 Query: 1284 PPPPPPPPP 1258 PP PPPPPP Sbjct: 20 PPAPPPPPP 28 Score = 23.8 bits (49), Expect(2) = 6.4 Identities = 7/7 (100%), Positives = 7/7 (100%) Frame = -2 Query: 1158 PPPPPPP 1138 PPPPPPP Sbjct: 23 PPPPPPP 29 >AF551763-1|AAN64133.1| 928|Homo sapiens retinoblastoma 1 (including osteosarcoma) protein. Length = 928 Score = 26.2 bits (55), Expect(2) = 6.4 Identities = 8/9 (88%), Positives = 8/9 (88%) Frame = -2 Query: 1284 PPPPPPPPP 1258 PP PPPPPP Sbjct: 20 PPAPPPPPP 28 Score = 23.8 bits (49), Expect(2) = 6.4 Identities = 7/7 (100%), Positives = 7/7 (100%) Frame = -2 Query: 1158 PPPPPPP 1138 PPPPPPP Sbjct: 23 PPPPPPP 29 >AJ133727-1|CAB42630.1| 889|Homo sapiens hyperpolarization-activated cyclic nucleotide-gated channel hHCN2 protein. Length = 889 Score = 26.2 bits (55), Expect(2) = 6.4 Identities = 8/9 (88%), Positives = 8/9 (88%) Frame = -2 Query: 1284 PPPPPPPPP 1258 PPPPPPP P Sbjct: 22 PPPPPPPAP 30 Score = 23.8 bits (49), Expect(2) = 6.4 Identities = 7/7 (100%), Positives = 7/7 (100%) Frame = -2 Query: 1158 PPPPPPP 1138 PPPPPPP Sbjct: 35 PPPPPPP 41 >AJ012582-1|CAB42602.1| 889|Homo sapiens hyperpolarization-activated cation channel HCN2 protein. Length = 889 Score = 26.2 bits (55), Expect(2) = 6.4 Identities = 8/9 (88%), Positives = 8/9 (88%) Frame = -2 Query: 1284 PPPPPPPPP 1258 PPPPPPP P Sbjct: 22 PPPPPPPAP 30 Score = 23.8 bits (49), Expect(2) = 6.4 Identities = 7/7 (100%), Positives = 7/7 (100%) Frame = -2 Query: 1158 PPPPPPP 1138 PPPPPPP Sbjct: 35 PPPPPPP 41 >AB028999-1|BAA83028.1| 804|Homo sapiens KIAA1076 protein protein. Length = 804 Score = 26.2 bits (55), Expect(2) = 6.4 Identities = 8/9 (88%), Positives = 8/9 (88%) Frame = -2 Query: 1284 PPPPPPPPP 1258 PP PPPPPP Sbjct: 425 PPQPPPPPP 433 Score = 23.8 bits (49), Expect(2) = 6.4 Identities = 7/7 (100%), Positives = 7/7 (100%) Frame = -2 Query: 1158 PPPPPPP 1138 PPPPPPP Sbjct: 429 PPPPPPP 435 >AK095189-1|BAC04495.1| 634|Homo sapiens protein ( Homo sapiens cDNA FLJ37870 fis, clone BRSSN2017682, highly similar to Mus musculus p300 transcriptional cofactor JMY mRNA. ). Length = 634 Score = 26.2 bits (55), Expect(2) = 6.6 Identities = 8/9 (88%), Positives = 8/9 (88%) Frame = -2 Query: 1284 PPPPPPPPP 1258 PP PPPPPP Sbjct: 454 PPTPPPPPP 462 Score = 23.8 bits (49), Expect(2) = 6.6 Identities = 7/7 (100%), Positives = 7/7 (100%) Frame = -2 Query: 1158 PPPPPPP 1138 PPPPPPP Sbjct: 458 PPPPPPP 464 >BC023587-1|AAH23587.1| 523|Homo sapiens REST corepressor 2 protein. Length = 523 Score = 26.2 bits (55), Expect(2) = 6.7 Identities = 8/9 (88%), Positives = 8/9 (88%) Frame = -2 Query: 1284 PPPPPPPPP 1258 PP PPPPPP Sbjct: 434 PPAPPPPPP 442 Score = 23.8 bits (49), Expect(2) = 6.7 Identities = 7/7 (100%), Positives = 7/7 (100%) Frame = -2 Query: 1158 PPPPPPP 1138 PPPPPPP Sbjct: 437 PPPPPPP 443 >BC095481-1|AAH95481.1| 591|Homo sapiens enabled homolog (Drosophila) protein. Length = 591 Score = 31.5 bits (68), Expect = 6.9 Identities = 17/49 (34%), Positives = 17/49 (34%) Frame = -2 Query: 1284 PPPPPPPPPXXXXXXXXXXXXGGGGGXXXPXXXXXXXXXXXXPPPPPPP 1138 PPPPPP PP G P PPPPPPP Sbjct: 313 PPPPPPLPPGPAQASVALPPPPG------PPPPPPLPSTGPPPPPPPPP 355 Score = 31.5 bits (68), Expect = 6.9 Identities = 17/48 (35%), Positives = 17/48 (35%) Frame = -3 Query: 1283 PPPPPPPPXXXXXXXXXXXXXXGGXGXXXPPXXXXXXXXXXPPPPPPP 1140 PPPP PPP G PP PPPPPPP Sbjct: 331 PPPPGPPPPPPLP----------STGPPPPPPPPPLPNQVPPPPPPPP 368 >BC065238-1|AAH65238.1| 527|Homo sapiens ENAH protein protein. Length = 527 Score = 31.5 bits (68), Expect = 6.9 Identities = 17/49 (34%), Positives = 17/49 (34%) Frame = -2 Query: 1284 PPPPPPPPPXXXXXXXXXXXXGGGGGXXXPXXXXXXXXXXXXPPPPPPP 1138 PPPPPP PP G P PPPPPPP Sbjct: 270 PPPPPPLPPGPAQASVALPPPPG------PPPPPPLPSTGPPPPPPPPP 312 Score = 31.5 bits (68), Expect = 6.9 Identities = 17/48 (35%), Positives = 17/48 (35%) Frame = -3 Query: 1283 PPPPPPPPXXXXXXXXXXXXXXGGXGXXXPPXXXXXXXXXXPPPPPPP 1140 PPPP PPP G PP PPPPPPP Sbjct: 288 PPPPGPPPPPPLP----------STGPPPPPPPPPLPNQVPPPPPPPP 325 >AY374131-1|AAQ82697.1| 275|Homo sapiens truncated C1-tetrahydrofolate synthase protein. Length = 275 Score = 31.5 bits (68), Expect = 6.9 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = +3 Query: 1206 PXPPXPXXXXXXXXXXXXGGGGGGGGG 1286 P PP P GGGGGGGGG Sbjct: 16 PQPPGPPRRLRVPCRASSGGGGGGGGG 42 >AY374130-1|AAQ82696.1| 978|Homo sapiens C1-tetrahydrofolate synthase protein. Length = 978 Score = 31.5 bits (68), Expect = 6.9 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = +3 Query: 1206 PXPPXPXXXXXXXXXXXXGGGGGGGGG 1286 P PP P GGGGGGGGG Sbjct: 16 PQPPGPPRRLRVPCRASSGGGGGGGGG 42 >AY345143-1|AAR04685.1| 570|Homo sapiens MENA protein. Length = 570 Score = 31.5 bits (68), Expect = 6.9 Identities = 17/49 (34%), Positives = 17/49 (34%) Frame = -2 Query: 1284 PPPPPPPPPXXXXXXXXXXXXGGGGGXXXPXXXXXXXXXXXXPPPPPPP 1138 PPPPPP PP G P PPPPPPP Sbjct: 313 PPPPPPLPPGPAQASVALPPPPG------PPPPPPLPSTGPPPPPPPPP 355 Score = 31.5 bits (68), Expect = 6.9 Identities = 17/48 (35%), Positives = 17/48 (35%) Frame = -3 Query: 1283 PPPPPPPPXXXXXXXXXXXXXXGGXGXXXPPXXXXXXXXXXPPPPPPP 1140 PPPP PPP G PP PPPPPPP Sbjct: 331 PPPPGPPPPPPLP----------STGPPPPPPPPPLPNQVPPPPPPPP 368 >AY157990-1|AAN76325.1| 1778|Homo sapiens myeloid/lymphoid or mixed-lineage leukemia 5 protein. Length = 1778 Score = 31.5 bits (68), Expect = 6.9 Identities = 17/49 (34%), Positives = 17/49 (34%) Frame = -2 Query: 1284 PPPPPPPPPXXXXXXXXXXXXGGGGGXXXPXXXXXXXXXXXXPPPPPPP 1138 PPPPPPP P G G PPPPPPP Sbjct: 1598 PPPPPPPGPAPHHHPPPHPSTGLQG---LQAQHQHVVNSAPPPPPPPPP 1643 >AY147037-1|AAN17675.1| 1858|Homo sapiens MLL5 protein. Length = 1858 Score = 31.5 bits (68), Expect = 6.9 Identities = 17/49 (34%), Positives = 17/49 (34%) Frame = -2 Query: 1284 PPPPPPPPPXXXXXXXXXXXXGGGGGXXXPXXXXXXXXXXXXPPPPPPP 1138 PPPPPPP P G G PPPPPPP Sbjct: 1678 PPPPPPPGPAPHHHPPPHPSTGLQG---LQAQHQHVVNSAPPPPPPPPP 1723 >AL591380-2|CAH71476.1| 570|Homo sapiens enabled homolog (Drosophila) protein. Length = 570 Score = 31.5 bits (68), Expect = 6.9 Identities = 17/49 (34%), Positives = 17/49 (34%) Frame = -2 Query: 1284 PPPPPPPPPXXXXXXXXXXXXGGGGGXXXPXXXXXXXXXXXXPPPPPPP 1138 PPPPPP PP G P PPPPPPP Sbjct: 313 PPPPPPLPPGPAQASVALPPPPG------PPPPPPLPSTGPPPPPPPPP 355 Score = 31.5 bits (68), Expect = 6.9 Identities = 17/48 (35%), Positives = 17/48 (35%) Frame = -3 Query: 1283 PPPPPPPPXXXXXXXXXXXXXXGGXGXXXPPXXXXXXXXXXPPPPPPP 1140 PPPP PPP G PP PPPPPPP Sbjct: 331 PPPPGPPPPPPLP----------STGPPPPPPPPPLPNQVPPPPPPPP 368 >AL591380-1|CAH71475.1| 817|Homo sapiens enabled homolog (Drosophila) protein. Length = 817 Score = 31.5 bits (68), Expect = 6.9 Identities = 17/49 (34%), Positives = 17/49 (34%) Frame = -2 Query: 1284 PPPPPPPPPXXXXXXXXXXXXGGGGGXXXPXXXXXXXXXXXXPPPPPPP 1138 PPPPPP PP G P PPPPPPP Sbjct: 560 PPPPPPLPPGPAQASVALPPPPG------PPPPPPLPSTGPPPPPPPPP 602 Score = 31.5 bits (68), Expect = 6.9 Identities = 17/48 (35%), Positives = 17/48 (35%) Frame = -3 Query: 1283 PPPPPPPPXXXXXXXXXXXXXXGGXGXXXPPXXXXXXXXXXPPPPPPP 1140 PPPP PPP G PP PPPPPPP Sbjct: 578 PPPPGPPPPPPLP----------STGPPPPPPPPPLPNQVPPPPPPPP 615 >AL356216-3|CAI22019.1| 570|Homo sapiens enabled homolog (Drosophila) protein. Length = 570 Score = 31.5 bits (68), Expect = 6.9 Identities = 17/49 (34%), Positives = 17/49 (34%) Frame = -2 Query: 1284 PPPPPPPPPXXXXXXXXXXXXGGGGGXXXPXXXXXXXXXXXXPPPPPPP 1138 PPPPPP PP G P PPPPPPP Sbjct: 313 PPPPPPLPPGPAQASVALPPPPG------PPPPPPLPSTGPPPPPPPPP 355 Score = 31.5 bits (68), Expect = 6.9 Identities = 17/48 (35%), Positives = 17/48 (35%) Frame = -3 Query: 1283 PPPPPPPPXXXXXXXXXXXXXXGGXGXXXPPXXXXXXXXXXPPPPPPP 1140 PPPP PPP G PP PPPPPPP Sbjct: 331 PPPPGPPPPPPLP----------STGPPPPPPPPPLPNQVPPPPPPPP 368 >AL356216-2|CAI22020.1| 817|Homo sapiens enabled homolog (Drosophila) protein. Length = 817 Score = 31.5 bits (68), Expect = 6.9 Identities = 17/49 (34%), Positives = 17/49 (34%) Frame = -2 Query: 1284 PPPPPPPPPXXXXXXXXXXXXGGGGGXXXPXXXXXXXXXXXXPPPPPPP 1138 PPPPPP PP G P PPPPPPP Sbjct: 560 PPPPPPLPPGPAQASVALPPPPG------PPPPPPLPSTGPPPPPPPPP 602 Score = 31.5 bits (68), Expect = 6.9 Identities = 17/48 (35%), Positives = 17/48 (35%) Frame = -3 Query: 1283 PPPPPPPPXXXXXXXXXXXXXXGGXGXXXPPXXXXXXXXXXPPPPPPP 1140 PPPP PPP G PP PPPPPPP Sbjct: 578 PPPPGPPPPPPLP----------STGPPPPPPPPPLPNQVPPPPPPPP 615 >AL133260-2|CAI95678.1| 978|Homo sapiens methylenetetrahydrofolate dehydrogenase (NADP+ dependent) 1-like protein. Length = 978 Score = 31.5 bits (68), Expect = 6.9 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = +3 Query: 1206 PXPPXPXXXXXXXXXXXXGGGGGGGGG 1286 P PP P GGGGGGGGG Sbjct: 16 PQPPGPPRRLRVPCRASSGGGGGGGGG 42 >AL049694-3|CAI95774.1| 978|Homo sapiens methylenetetrahydrofolate dehydrogenase (NADP+ dependent) 1-like protein. Length = 978 Score = 31.5 bits (68), Expect = 6.9 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = +3 Query: 1206 PXPPXPXXXXXXXXXXXXGGGGGGGGG 1286 P PP P GGGGGGGGG Sbjct: 16 PQPPGPPRRLRVPCRASSGGGGGGGGG 42 >AL035086-7|CAI42794.1| 978|Homo sapiens methylenetetrahydrofolate dehydrogenase (NADP+ dependent) 1-like protein. Length = 978 Score = 31.5 bits (68), Expect = 6.9 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = +3 Query: 1206 PXPPXPXXXXXXXXXXXXGGGGGGGGG 1286 P PP P GGGGGGGGG Sbjct: 16 PQPPGPPRRLRVPCRASSGGGGGGGGG 42 >AK096246-1|BAC04736.1| 467|Homo sapiens protein ( Homo sapiens cDNA FLJ38927 fis, clone NT2NE2012505, highly similar to Gallus gallus mRNA for avena. ). Length = 467 Score = 31.5 bits (68), Expect = 6.9 Identities = 17/49 (34%), Positives = 17/49 (34%) Frame = -2 Query: 1284 PPPPPPPPPXXXXXXXXXXXXGGGGGXXXPXXXXXXXXXXXXPPPPPPP 1138 PPPPPP PP G P PPPPPPP Sbjct: 210 PPPPPPLPPGPAQASVALPPPPG------PPPPPPLPSTGPPPPPPPPP 252 Score = 31.5 bits (68), Expect = 6.9 Identities = 17/48 (35%), Positives = 17/48 (35%) Frame = -3 Query: 1283 PPPPPPPPXXXXXXXXXXXXXXGGXGXXXPPXXXXXXXXXXPPPPPPP 1140 PPPP PPP G PP PPPPPPP Sbjct: 228 PPPPGPPPPPPLP----------STGPPPPPPPPPLPNQVPPPPPPPP 265 >AJ509090-1|CAD48858.1| 625|Homo sapiens Wiskott-Aldrich syndrome protein family member 4 protein. Length = 625 Score = 31.5 bits (68), Expect = 6.9 Identities = 17/51 (33%), Positives = 17/51 (33%), Gaps = 2/51 (3%) Frame = -2 Query: 1284 PPPPPPPPPXXXXXXXXXXXXGGGGGXXXP--XXXXXXXXXXXXPPPPPPP 1138 P PPPPPPP G G P PPP PPP Sbjct: 448 PAPPPPPPPMIGIPPPPPPIGFGSPGTPPPPSSPSFPPHPDFAAPPPLPPP 498 >AF519769-1|AAQ08487.1| 591|Homo sapiens mena protein protein. Length = 591 Score = 31.5 bits (68), Expect = 6.9 Identities = 17/49 (34%), Positives = 17/49 (34%) Frame = -2 Query: 1284 PPPPPPPPPXXXXXXXXXXXXGGGGGXXXPXXXXXXXXXXXXPPPPPPP 1138 PPPPPP PP G P PPPPPPP Sbjct: 313 PPPPPPLPPGPAQASVALPPPPG------PPPPPPLPSTGPPPPPPPPP 355 Score = 31.5 bits (68), Expect = 6.9 Identities = 17/48 (35%), Positives = 17/48 (35%) Frame = -3 Query: 1283 PPPPPPPPXXXXXXXXXXXXXXGGXGXXXPPXXXXXXXXXXPPPPPPP 1140 PPPP PPP G PP PPPPPPP Sbjct: 331 PPPPGPPPPPPLP----------STGPPPPPPPPPLPNQVPPPPPPPP 368 >AF519459-1|AAM74947.1| 1858|Homo sapiens MLL5 protein. Length = 1858 Score = 31.5 bits (68), Expect = 6.9 Identities = 17/49 (34%), Positives = 17/49 (34%) Frame = -2 Query: 1284 PPPPPPPPPXXXXXXXXXXXXGGGGGXXXPXXXXXXXXXXXXPPPPPPP 1138 PPPPPPP P G G PPPPPPP Sbjct: 1678 PPPPPPPGPAPHHHPPPHPSTGLQG---LQAQHQHVVNSAPPPPPPPPP 1723 >AF134304-1|AAD33053.2| 496|Homo sapiens Scar2 protein. Length = 496 Score = 31.5 bits (68), Expect = 6.9 Identities = 17/51 (33%), Positives = 17/51 (33%), Gaps = 2/51 (3%) Frame = -2 Query: 1284 PPPPPPPPPXXXXXXXXXXXXGGGGGXXXP--XXXXXXXXXXXXPPPPPPP 1138 P PPPPPPP G G P PPP PPP Sbjct: 319 PAPPPPPPPMIGIPPPPPPIGFGSPGTPPPPSSPSFPPHPDFAAPPPLPPP 369 >AB127387-1|BAD93193.1| 978|Homo sapiens mitochondrial C1-tetrahydrofolate synthetase protein. Length = 978 Score = 31.5 bits (68), Expect = 6.9 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = +3 Query: 1206 PXPPXPXXXXXXXXXXXXGGGGGGGGG 1286 P PP P GGGGGGGGG Sbjct: 16 PQPPGPPRRLRVPCRASSGGGGGGGGG 42 >AF134053-1|AAD55891.1| 355|Homo sapiens Kruppel-like factor LKLF protein. Length = 355 Score = 26.2 bits (55), Expect(2) = 6.9 Identities = 8/9 (88%), Positives = 8/9 (88%) Frame = -2 Query: 1284 PPPPPPPPP 1258 P PPPPPPP Sbjct: 62 PEPPPPPPP 70 Score = 23.8 bits (49), Expect(2) = 6.9 Identities = 7/7 (100%), Positives = 7/7 (100%) Frame = -2 Query: 1158 PPPPPPP 1138 PPPPPPP Sbjct: 65 PPPPPPP 71 >AK126559-1|BAC86594.1| 308|Homo sapiens protein ( Homo sapiens cDNA FLJ44595 fis, clone BLADE2004849. ). Length = 308 Score = 26.2 bits (55), Expect(2) = 7.0 Identities = 8/9 (88%), Positives = 8/9 (88%) Frame = -2 Query: 1284 PPPPPPPPP 1258 P PPPPPPP Sbjct: 164 PKPPPPPPP 172 Score = 23.8 bits (49), Expect(2) = 7.0 Identities = 7/7 (100%), Positives = 7/7 (100%) Frame = -2 Query: 1158 PPPPPPP 1138 PPPPPPP Sbjct: 167 PPPPPPP 173 >BC010608-1|AAH10608.1| 305|Homo sapiens RCOR2 protein protein. Length = 305 Score = 26.2 bits (55), Expect(2) = 7.0 Identities = 8/9 (88%), Positives = 8/9 (88%) Frame = -2 Query: 1284 PPPPPPPPP 1258 PP PPPPPP Sbjct: 216 PPAPPPPPP 224 Score = 23.8 bits (49), Expect(2) = 7.0 Identities = 7/7 (100%), Positives = 7/7 (100%) Frame = -2 Query: 1158 PPPPPPP 1138 PPPPPPP Sbjct: 219 PPPPPPP 225 >AB023171-1|BAA76798.2| 1183|Homo sapiens KIAA0954 protein protein. Length = 1183 Score = 25.8 bits (54), Expect(2) = 8.1 Identities = 8/9 (88%), Positives = 8/9 (88%) Frame = -2 Query: 1284 PPPPPPPPP 1258 P PPPPPPP Sbjct: 218 PGPPPPPPP 226 Score = 23.8 bits (49), Expect(2) = 8.1 Identities = 7/7 (100%), Positives = 7/7 (100%) Frame = -2 Query: 1158 PPPPPPP 1138 PPPPPPP Sbjct: 221 PPPPPPP 227 >AF086762-1|AAF28400.1| 1111|Homo sapiens C11orf9 protein. Length = 1111 Score = 25.8 bits (54), Expect(2) = 8.2 Identities = 8/9 (88%), Positives = 8/9 (88%) Frame = -2 Query: 1284 PPPPPPPPP 1258 P PPPPPPP Sbjct: 177 PGPPPPPPP 185 Score = 23.8 bits (49), Expect(2) = 8.2 Identities = 7/7 (100%), Positives = 7/7 (100%) Frame = -2 Query: 1158 PPPPPPP 1138 PPPPPPP Sbjct: 180 PPPPPPP 186 >AL591502-3|CAI12581.1| 941|Homo sapiens gamma-aminobutyric acid (GABA) B receptor, 2 protein. Length = 941 Score = 25.8 bits (54), Expect(2) = 8.3 Identities = 8/9 (88%), Positives = 8/9 (88%) Frame = -2 Query: 1284 PPPPPPPPP 1258 P PPPPPPP Sbjct: 10 PGPPPPPPP 18 Score = 23.8 bits (49), Expect(2) = 8.3 Identities = 7/7 (100%), Positives = 7/7 (100%) Frame = -2 Query: 1158 PPPPPPP 1138 PPPPPPP Sbjct: 14 PPPPPPP 20 >AL445495-1|CAD13322.2| 941|Homo sapiens gamma-aminobutyric acid (GABA) B receptor, 2 protein. Length = 941 Score = 25.8 bits (54), Expect(2) = 8.3 Identities = 8/9 (88%), Positives = 8/9 (88%) Frame = -2 Query: 1284 PPPPPPPPP 1258 P PPPPPPP Sbjct: 10 PGPPPPPPP 18 Score = 23.8 bits (49), Expect(2) = 8.3 Identities = 7/7 (100%), Positives = 7/7 (100%) Frame = -2 Query: 1158 PPPPPPP 1138 PPPPPPP Sbjct: 14 PPPPPPP 20 >AL356282-1|CAH72233.1| 941|Homo sapiens gamma-aminobutyric acid (GABA) B receptor, 2 protein. Length = 941 Score = 25.8 bits (54), Expect(2) = 8.3 Identities = 8/9 (88%), Positives = 8/9 (88%) Frame = -2 Query: 1284 PPPPPPPPP 1258 P PPPPPPP Sbjct: 10 PGPPPPPPP 18 Score = 23.8 bits (49), Expect(2) = 8.3 Identities = 7/7 (100%), Positives = 7/7 (100%) Frame = -2 Query: 1158 PPPPPPP 1138 PPPPPPP Sbjct: 14 PPPPPPP 20 >AL353782-5|CAH71298.1| 941|Homo sapiens gamma-aminobutyric acid (GABA) B receptor, 2 protein. Length = 941 Score = 25.8 bits (54), Expect(2) = 8.3 Identities = 8/9 (88%), Positives = 8/9 (88%) Frame = -2 Query: 1284 PPPPPPPPP 1258 P PPPPPPP Sbjct: 10 PGPPPPPPP 18 Score = 23.8 bits (49), Expect(2) = 8.3 Identities = 7/7 (100%), Positives = 7/7 (100%) Frame = -2 Query: 1158 PPPPPPP 1138 PPPPPPP Sbjct: 14 PPPPPPP 20 >AJ012188-1|CAA09942.1| 941|Homo sapiens GABAB receptor, subunit 2 protein. Length = 941 Score = 25.8 bits (54), Expect(2) = 8.3 Identities = 8/9 (88%), Positives = 8/9 (88%) Frame = -2 Query: 1284 PPPPPPPPP 1258 P PPPPPPP Sbjct: 10 PGPPPPPPP 18 Score = 23.8 bits (49), Expect(2) = 8.3 Identities = 7/7 (100%), Positives = 7/7 (100%) Frame = -2 Query: 1158 PPPPPPP 1138 PPPPPPP Sbjct: 14 PPPPPPP 20 >AF099033-1|AAD45867.1| 941|Homo sapiens gamma-aminobutyric acid type B receptor 2 protein. Length = 941 Score = 25.8 bits (54), Expect(2) = 8.3 Identities = 8/9 (88%), Positives = 8/9 (88%) Frame = -2 Query: 1284 PPPPPPPPP 1258 P PPPPPPP Sbjct: 10 PGPPPPPPP 18 Score = 23.8 bits (49), Expect(2) = 8.3 Identities = 7/7 (100%), Positives = 7/7 (100%) Frame = -2 Query: 1158 PPPPPPP 1138 PPPPPPP Sbjct: 14 PPPPPPP 20 >AF095784-1|AAD30389.1| 941|Homo sapiens GABA-B receptor R2 protein. Length = 941 Score = 25.8 bits (54), Expect(2) = 8.3 Identities = 8/9 (88%), Positives = 8/9 (88%) Frame = -2 Query: 1284 PPPPPPPPP 1258 P PPPPPPP Sbjct: 10 PGPPPPPPP 18 Score = 23.8 bits (49), Expect(2) = 8.3 Identities = 7/7 (100%), Positives = 7/7 (100%) Frame = -2 Query: 1158 PPPPPPP 1138 PPPPPPP Sbjct: 14 PPPPPPP 20 >AF074483-1|AAD03336.1| 941|Homo sapiens GABA-B receptor 2 protein. Length = 941 Score = 25.8 bits (54), Expect(2) = 8.3 Identities = 8/9 (88%), Positives = 8/9 (88%) Frame = -2 Query: 1284 PPPPPPPPP 1258 P PPPPPPP Sbjct: 10 PGPPPPPPP 18 Score = 23.8 bits (49), Expect(2) = 8.3 Identities = 7/7 (100%), Positives = 7/7 (100%) Frame = -2 Query: 1158 PPPPPPP 1138 PPPPPPP Sbjct: 14 PPPPPPP 20 >AF056085-1|AAC63228.1| 941|Homo sapiens GABA-B receptor protein. Length = 941 Score = 25.8 bits (54), Expect(2) = 8.3 Identities = 8/9 (88%), Positives = 8/9 (88%) Frame = -2 Query: 1284 PPPPPPPPP 1258 P PPPPPPP Sbjct: 10 PGPPPPPPP 18 Score = 23.8 bits (49), Expect(2) = 8.3 Identities = 7/7 (100%), Positives = 7/7 (100%) Frame = -2 Query: 1158 PPPPPPP 1138 PPPPPPP Sbjct: 14 PPPPPPP 20 >X16439-1|CAA34462.1| 45|Homo sapiens protein ( Human retinoblastoma gene 5'-region fragment. ). Length = 45 Score = 26.2 bits (55), Expect(2) = 8.8 Identities = 8/9 (88%), Positives = 8/9 (88%) Frame = -2 Query: 1284 PPPPPPPPP 1258 PP PPPPPP Sbjct: 20 PPAPPPPPP 28 Score = 23.8 bits (49), Expect(2) = 8.8 Identities = 7/7 (100%), Positives = 7/7 (100%) Frame = -2 Query: 1158 PPPPPPP 1138 PPPPPPP Sbjct: 23 PPPPPPP 29 >M19701-1|AAA60259.1| 53|Homo sapiens RB1 protein. Length = 53 Score = 26.2 bits (55), Expect(2) = 8.8 Identities = 8/9 (88%), Positives = 8/9 (88%) Frame = -2 Query: 1284 PPPPPPPPP 1258 PP PPPPPP Sbjct: 20 PPAPPPPPP 28 Score = 23.8 bits (49), Expect(2) = 8.8 Identities = 7/7 (100%), Positives = 7/7 (100%) Frame = -2 Query: 1158 PPPPPPP 1138 PPPPPPP Sbjct: 23 PPPPPPP 29 >L41889-1|AAB59467.1| 45|Homo sapiens retinoblastoma suspectibility protein protein. Length = 45 Score = 26.2 bits (55), Expect(2) = 8.8 Identities = 8/9 (88%), Positives = 8/9 (88%) Frame = -2 Query: 1284 PPPPPPPPP 1258 PP PPPPPP Sbjct: 20 PPAPPPPPP 28 Score = 23.8 bits (49), Expect(2) = 8.8 Identities = 7/7 (100%), Positives = 7/7 (100%) Frame = -2 Query: 1158 PPPPPPP 1138 PPPPPPP Sbjct: 23 PPPPPPP 29 >BC043498-1|AAH43498.1| 333|Homo sapiens mitochondrial fission regulator 1 protein. Length = 333 Score = 25.8 bits (54), Expect(2) = 9.0 Identities = 8/9 (88%), Positives = 8/9 (88%) Frame = -2 Query: 1284 PPPPPPPPP 1258 PP PPPPPP Sbjct: 184 PPHPPPPPP 192 Score = 23.8 bits (49), Expect(2) = 9.0 Identities = 7/7 (100%), Positives = 7/7 (100%) Frame = -2 Query: 1158 PPPPPPP 1138 PPPPPPP Sbjct: 187 PPPPPPP 193 >BC036116-1|AAH36116.1| 333|Homo sapiens mitochondrial fission regulator 1 protein. Length = 333 Score = 25.8 bits (54), Expect(2) = 9.0 Identities = 8/9 (88%), Positives = 8/9 (88%) Frame = -2 Query: 1284 PPPPPPPPP 1258 PP PPPPPP Sbjct: 184 PPHPPPPPP 192 Score = 23.8 bits (49), Expect(2) = 9.0 Identities = 7/7 (100%), Positives = 7/7 (100%) Frame = -2 Query: 1158 PPPPPPP 1138 PPPPPPP Sbjct: 187 PPPPPPP 193 >D13634-1|BAA02798.1| 314|Homo sapiens KIAA0009 protein. Length = 314 Score = 25.8 bits (54), Expect(2) = 9.0 Identities = 8/9 (88%), Positives = 8/9 (88%) Frame = -2 Query: 1284 PPPPPPPPP 1258 PP PPPPPP Sbjct: 165 PPHPPPPPP 173 Score = 23.8 bits (49), Expect(2) = 9.0 Identities = 7/7 (100%), Positives = 7/7 (100%) Frame = -2 Query: 1158 PPPPPPP 1138 PPPPPPP Sbjct: 168 PPPPPPP 174 >CR456910-1|CAG33191.1| 314|Homo sapiens CHPPR protein. Length = 314 Score = 25.8 bits (54), Expect(2) = 9.0 Identities = 8/9 (88%), Positives = 8/9 (88%) Frame = -2 Query: 1284 PPPPPPPPP 1258 PP PPPPPP Sbjct: 165 PPHPPPPPP 173 Score = 23.8 bits (49), Expect(2) = 9.0 Identities = 7/7 (100%), Positives = 7/7 (100%) Frame = -2 Query: 1158 PPPPPPP 1138 PPPPPPP Sbjct: 168 PPPPPPP 174 >BC049204-1|AAH49204.1| 251|Homo sapiens homeobox B4 protein. Length = 251 Score = 31.1 bits (67), Expect = 9.1 Identities = 16/49 (32%), Positives = 16/49 (32%), Gaps = 2/49 (4%) Frame = -2 Query: 1284 PPPPPPPPPXXXXXXXXXXXXGG--GGGXXXPXXXXXXXXXXXXPPPPP 1144 PPPPPPPPP G P PPPPP Sbjct: 73 PPPPPPPPPPPPPPPGLSPRAPAPPPAGALLPEPGQRCEAVSSSPPPPP 121 >AL137449-1|CAB70742.1| 246|Homo sapiens hypothetical protein protein. Length = 246 Score = 31.1 bits (67), Expect = 9.1 Identities = 16/49 (32%), Positives = 16/49 (32%), Gaps = 2/49 (4%) Frame = -2 Query: 1284 PPPPPPPPPXXXXXXXXXXXXGG--GGGXXXPXXXXXXXXXXXXPPPPP 1144 PPPPPPPPP G P PPPPP Sbjct: 68 PPPPPPPPPPPPPPPGLSPRAPAPPPAGALLPEPGQRCEAVSSSPPPPP 116 >AF307160-1|AAG45052.1| 251|Homo sapiens HOXB4 protein. Length = 251 Score = 31.1 bits (67), Expect = 9.1 Identities = 16/49 (32%), Positives = 16/49 (32%), Gaps = 2/49 (4%) Frame = -2 Query: 1284 PPPPPPPPPXXXXXXXXXXXXGG--GGGXXXPXXXXXXXXXXXXPPPPP 1144 PPPPPPPPP G P PPPPP Sbjct: 73 PPPPPPPPPPPPPPPGLSPRAPAPPPAGALLPEPGQRCEAVSSSPPPPP 121 >AF287967-4|AAG31554.1| 251|Homo sapiens homeobox B4 protein. Length = 251 Score = 31.1 bits (67), Expect = 9.1 Identities = 16/49 (32%), Positives = 16/49 (32%), Gaps = 2/49 (4%) Frame = -2 Query: 1284 PPPPPPPPPXXXXXXXXXXXXGG--GGGXXXPXXXXXXXXXXXXPPPPP 1144 PPPPPPPPP G P PPPPP Sbjct: 73 PPPPPPPPPPPPPPPGLSPRAPAPPPAGALLPEPGQRCEAVSSSPPPPP 121 >BX537854-1|CAD97862.1| 290|Homo sapiens hypothetical protein protein. Length = 290 Score = 25.8 bits (54), Expect(2) = 9.1 Identities = 8/9 (88%), Positives = 8/9 (88%) Frame = -2 Query: 1284 PPPPPPPPP 1258 PP PPPPPP Sbjct: 141 PPHPPPPPP 149 Score = 23.8 bits (49), Expect(2) = 9.1 Identities = 7/7 (100%), Positives = 7/7 (100%) Frame = -2 Query: 1158 PPPPPPP 1138 PPPPPPP Sbjct: 144 PPPPPPP 150 >AK093350-1|BAC04142.1| 231|Homo sapiens protein ( Homo sapiens cDNA FLJ36031 fis, clone TESTI2017028. ). Length = 231 Score = 25.8 bits (54), Expect(2) = 9.3 Identities = 8/9 (88%), Positives = 8/9 (88%) Frame = -2 Query: 1284 PPPPPPPPP 1258 P PPPPPPP Sbjct: 143 PRPPPPPPP 151 Score = 23.8 bits (49), Expect(2) = 9.3 Identities = 7/7 (100%), Positives = 7/7 (100%) Frame = -2 Query: 1158 PPPPPPP 1138 PPPPPPP Sbjct: 146 PPPPPPP 152 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 152,730,918 Number of Sequences: 237096 Number of extensions: 3795319 Number of successful extensions: 118916 Number of sequences better than 10.0: 168 Number of HSP's better than 10.0 without gapping: 4771 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 50450 length of database: 76,859,062 effective HSP length: 92 effective length of database: 55,046,230 effective search space used: 18495533280 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -