BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= FWDP01_FL5_P09 (857 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 06_03_0267 + 18970578-18972464 29 6.3 12_02_0017 - 12357029-12357070,12357434-12357503,12357722-123578... 28 8.3 >06_03_0267 + 18970578-18972464 Length = 628 Score = 28.7 bits (61), Expect = 6.3 Identities = 15/46 (32%), Positives = 20/46 (43%) Frame = -3 Query: 549 RCVVEQCFLVVRXEGPCCHQHAGQEHRWAVSACS*KSH*MADRCSS 412 RCVV C R CC +H G + R + CS + D C + Sbjct: 448 RCVVPGCTKSARGRTDCCVRHGGGK-RCQFTGCSKSAQGSTDFCKA 492 >12_02_0017 - 12357029-12357070,12357434-12357503,12357722-12357852, 12358836-12358882,12359762-12360044,12360547-12362413, 12362454-12362665 Length = 883 Score = 28.3 bits (60), Expect = 8.3 Identities = 11/28 (39%), Positives = 16/28 (57%) Frame = +3 Query: 474 APAQHADDSMDPLXVPQGSTAPQRTARH 557 AP++HA S P P ++AP + RH Sbjct: 79 APSRHATPSSSPPSTPSSASAPPPSGRH 106 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 20,206,130 Number of Sequences: 37544 Number of extensions: 380625 Number of successful extensions: 826 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 799 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 826 length of database: 14,793,348 effective HSP length: 81 effective length of database: 11,752,284 effective search space used: 2397465936 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -