BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= FWDP01_FL5_P08 (858 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 11_01_0114 - 886404-887111 31 1.6 05_07_0146 + 28018236-28018580,28018670-28018777,28018984-280191... 30 2.7 04_03_1040 - 21920659-21920856,21920943-21921110,21921173-21922012 29 6.3 03_06_0158 + 32052426-32052529,32052645-32052702,32052847-320529... 28 8.3 >11_01_0114 - 886404-887111 Length = 235 Score = 30.7 bits (66), Expect = 1.6 Identities = 22/82 (26%), Positives = 38/82 (46%), Gaps = 4/82 (4%) Frame = +1 Query: 394 TPSSSTNGTETLVPEDNLYALMPPFETFLNVD----KTARLRHFFDNVKTGELIIGAVIN 561 T +++ NG+ +++P + A PPF T + D + R R L++ V+ Sbjct: 5 TAAAAGNGSGSILPTHTIAATAPPFRTHKDADLESRRRRRRRRCLCCCLLVTLVVLLVLA 64 Query: 562 RTASGMMLKVLCTAGPTSRYVA 627 T + L VL PT+R V+ Sbjct: 65 ITLLVLFLTVLRVRDPTTRLVS 86 >05_07_0146 + 28018236-28018580,28018670-28018777,28018984-28019148, 28019269-28019736,28019823-28019936,28020038-28020715 Length = 625 Score = 29.9 bits (64), Expect = 2.7 Identities = 17/43 (39%), Positives = 28/43 (65%) Frame = -2 Query: 473 VSNGGINAYKLSSGTRVSVPLVDDEGVSSSKEESNKAPASLAM 345 ++ G + + +SG+ S+ VDD GVSS+ EE +A A+LA+ Sbjct: 114 INMGLLVGRRRNSGSEESI--VDDGGVSSNDEEHREAKAALAV 154 >04_03_1040 - 21920659-21920856,21920943-21921110,21921173-21922012 Length = 401 Score = 28.7 bits (61), Expect = 6.3 Identities = 13/35 (37%), Positives = 21/35 (60%), Gaps = 1/35 (2%) Frame = -1 Query: 753 IWNNFYDFAANSVI-HQVVS*HIFLVNSLNNISYW 652 +W NF DFA N ++ HQ+ F ++ +NN+ W Sbjct: 80 VWQNFEDFADNLMLHHQIAHLDTFQLH-VNNVYRW 113 >03_06_0158 + 32052426-32052529,32052645-32052702,32052847-32052983, 32053824-32053899,32053965-32054017,32054415-32054896, 32055097-32055184,32055482-32055665,32056443-32056640, 32057351-32057534,32057982-32058109,32058236-32058317, 32058444-32058496,32058625-32058700,32059253-32059314 Length = 654 Score = 28.3 bits (60), Expect = 8.3 Identities = 18/63 (28%), Positives = 30/63 (47%) Frame = +1 Query: 253 GVGALDFAVYQSRHKHLTFQDRSKRLKLHQFIAKEAGALFDSSLLEDTPSSSTNGTETLV 432 GVG D+ ++ + ++ FQ+ S + H A +A L DS L + + T G + Sbjct: 593 GVGPWDYPIFSDLYPNVMFQEPSGLIYGHVVEADQA-FLPDSHELANADNQFTGGNDDSA 651 Query: 433 PED 441 P D Sbjct: 652 PFD 654 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 21,203,280 Number of Sequences: 37544 Number of extensions: 412526 Number of successful extensions: 911 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 891 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 911 length of database: 14,793,348 effective HSP length: 81 effective length of database: 11,752,284 effective search space used: 2397465936 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -