BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= FWDP01_FL5_P07 (828 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY137766-1|AAM94344.1| 78|Anopheles gambiae heat shock protein... 106 9e-25 AY534996-1|AAT07394.1| 471|Anopheles gambiae XK-related b protein. 24 6.6 >AY137766-1|AAM94344.1| 78|Anopheles gambiae heat shock protein 70 protein. Length = 78 Score = 106 bits (254), Expect = 9e-25 Identities = 51/61 (83%), Positives = 55/61 (90%) Frame = +3 Query: 510 NAVITVPAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGXRXVLIFDL 689 +AVITVPAYFNDSQRQATKDAG I+GLNV+RIINEPTAAA+AYGLDK G R VLIFDL Sbjct: 1 DAVITVPAYFNDSQRQATKDAGAIAGLNVMRIINEPTAAALAYGLDKNLKGERNVLIFDL 60 Query: 690 G 692 G Sbjct: 61 G 61 Score = 24.2 bits (50), Expect = 5.0 Identities = 10/11 (90%), Positives = 10/11 (90%) Frame = +1 Query: 691 GGGXFDVSILT 723 GGG FDVSILT Sbjct: 61 GGGTFDVSILT 71 >AY534996-1|AAT07394.1| 471|Anopheles gambiae XK-related b protein. Length = 471 Score = 23.8 bits (49), Expect = 6.6 Identities = 13/45 (28%), Positives = 23/45 (51%) Frame = -3 Query: 199 VLLPWSLAMISTFPCWKTPTQEXRGTQIDSYCGCFCHFVFLISLV 65 ++L W L +I F W+ T R + Y + H+VFL+ ++ Sbjct: 344 LVLTW-LGVIFQF-LWRLGTVISRVISLTVYASVYSHWVFLVIIL 386 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 841,057 Number of Sequences: 2352 Number of extensions: 18525 Number of successful extensions: 28 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 27 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 28 length of database: 563,979 effective HSP length: 63 effective length of database: 415,803 effective search space used: 88150236 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -