BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= FWDP01_FL5_P01 (835 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AB267886-1|BAF46356.1| 567|Apis mellifera ecdysteroid receptor ... 23 4.6 DQ325113-1|ABD14127.1| 185|Apis mellifera complementary sex det... 22 6.1 DQ325112-1|ABD14126.1| 185|Apis mellifera complementary sex det... 22 6.1 DQ325111-1|ABD14125.1| 185|Apis mellifera complementary sex det... 22 6.1 DQ325110-1|ABD14124.1| 185|Apis mellifera complementary sex det... 22 6.1 >AB267886-1|BAF46356.1| 567|Apis mellifera ecdysteroid receptor A isoform protein. Length = 567 Score = 22.6 bits (46), Expect = 4.6 Identities = 9/41 (21%), Positives = 20/41 (48%) Frame = -1 Query: 583 SKSIDIMLIISKLTTSNTFIVFSGDAVQSKVPVLFAATWEI 461 ++ + ++ + L N+ + FS K+PV A W++ Sbjct: 525 ARLLSVLTELRTLGNQNSEMCFSLKFKNKKLPVFLAEIWDV 565 >DQ325113-1|ABD14127.1| 185|Apis mellifera complementary sex determiner protein. Length = 185 Score = 22.2 bits (45), Expect = 6.1 Identities = 8/23 (34%), Positives = 16/23 (69%) Frame = -2 Query: 315 KLLSYVSDEGKFSRYSVSNSNTF 247 K++S +S+ K+S Y+ N+N + Sbjct: 80 KIISSLSNNYKYSNYNNYNNNNY 102 >DQ325112-1|ABD14126.1| 185|Apis mellifera complementary sex determiner protein. Length = 185 Score = 22.2 bits (45), Expect = 6.1 Identities = 8/23 (34%), Positives = 16/23 (69%) Frame = -2 Query: 315 KLLSYVSDEGKFSRYSVSNSNTF 247 K++S +S+ K+S Y+ N+N + Sbjct: 80 KIISSLSNNYKYSNYNNYNNNNY 102 >DQ325111-1|ABD14125.1| 185|Apis mellifera complementary sex determiner protein. Length = 185 Score = 22.2 bits (45), Expect = 6.1 Identities = 8/23 (34%), Positives = 16/23 (69%) Frame = -2 Query: 315 KLLSYVSDEGKFSRYSVSNSNTF 247 K++S +S+ K+S Y+ N+N + Sbjct: 80 KIISSLSNNYKYSNYNNYNNNNY 102 >DQ325110-1|ABD14124.1| 185|Apis mellifera complementary sex determiner protein. Length = 185 Score = 22.2 bits (45), Expect = 6.1 Identities = 8/23 (34%), Positives = 16/23 (69%) Frame = -2 Query: 315 KLLSYVSDEGKFSRYSVSNSNTF 247 K++S +S+ K+S Y+ N+N + Sbjct: 80 KIISSLSNNYKYSNYNNYNNNNY 102 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 189,751 Number of Sequences: 438 Number of extensions: 3586 Number of successful extensions: 16 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 16 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 16 length of database: 146,343 effective HSP length: 57 effective length of database: 121,377 effective search space used: 26702940 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -