BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= FWDP01_FL5_O21 (848 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value EF625898-1|ABR45905.1| 686|Apis mellifera hexamerin protein. 24 2.0 EF589162-1|ABQ84439.1| 686|Apis mellifera hexamerin 70c protein. 24 2.0 M29490-1|AAA27725.1| 109|Apis mellifera protein ( Bee homeobox-... 23 2.7 X72575-1|CAA51167.1| 168|Apis mellifera Apidaecin precursor pro... 23 3.6 DQ325109-1|ABD14123.1| 177|Apis mellifera complementary sex det... 22 6.2 DQ325108-1|ABD14122.1| 177|Apis mellifera complementary sex det... 22 6.2 DQ325106-1|ABD14120.1| 177|Apis mellifera complementary sex det... 22 6.2 AY350615-1|AAQ57657.1| 410|Apis mellifera complementary sex det... 22 6.2 M29489-1|AAA27724.1| 109|Apis mellifera protein ( Bee homeobox-... 22 8.2 DQ325107-1|ABD14121.1| 176|Apis mellifera complementary sex det... 22 8.2 DQ011226-1|AAY63895.1| 471|Apis mellifera Rh-like protein protein. 22 8.2 >EF625898-1|ABR45905.1| 686|Apis mellifera hexamerin protein. Length = 686 Score = 23.8 bits (49), Expect = 2.0 Identities = 10/32 (31%), Positives = 14/32 (43%) Frame = +2 Query: 449 RDCQGYQFTYRNPTQSKRRCLTQYMSQSTDPS 544 RD GY F ++N L Y + DP+ Sbjct: 388 RDILGYNFDFQNKNNLIPSALQSYSTSMRDPA 419 >EF589162-1|ABQ84439.1| 686|Apis mellifera hexamerin 70c protein. Length = 686 Score = 23.8 bits (49), Expect = 2.0 Identities = 10/32 (31%), Positives = 14/32 (43%) Frame = +2 Query: 449 RDCQGYQFTYRNPTQSKRRCLTQYMSQSTDPS 544 RD GY F ++N L Y + DP+ Sbjct: 388 RDILGYNFDFQNKNNLIPSALQSYSTSMRDPA 419 >M29490-1|AAA27725.1| 109|Apis mellifera protein ( Bee homeobox-containing gene,partial cds, clone E30. ). Length = 109 Score = 23.4 bits (48), Expect = 2.7 Identities = 10/20 (50%), Positives = 12/20 (60%) Frame = +3 Query: 534 QTRPRQGICARTLPRLKRKF 593 + RPR A L RLKR+F Sbjct: 20 EKRPRTAFSAEQLARLKREF 39 >X72575-1|CAA51167.1| 168|Apis mellifera Apidaecin precursor protein. Length = 168 Score = 23.0 bits (47), Expect = 3.6 Identities = 9/36 (25%), Positives = 15/36 (41%) Frame = +1 Query: 664 PVHVPAPYPVYKEVXXTXKVHVDRPYPVHFPTXAXP 771 PV++P P P + + + PV+ P P Sbjct: 103 PVYIPQPRPPHPRLRREPEAEPGNNRPVYIPQPRPP 138 Score = 23.0 bits (47), Expect = 3.6 Identities = 9/36 (25%), Positives = 15/36 (41%) Frame = +1 Query: 664 PVHVPAPYPVYKEVXXTXKVHVDRPYPVHFPTXAXP 771 PV++P P P + + + PV+ P P Sbjct: 129 PVYIPQPRPPHPRLRREPEAEPGNNRPVYIPQPRPP 164 >DQ325109-1|ABD14123.1| 177|Apis mellifera complementary sex determiner protein. Length = 177 Score = 22.2 bits (45), Expect = 6.2 Identities = 9/18 (50%), Positives = 11/18 (61%) Frame = +1 Query: 643 VXYPVKGPVHVPAPYPVY 696 + Y + PV VP P PVY Sbjct: 105 INYIEQIPVPVPVPVPVY 122 >DQ325108-1|ABD14122.1| 177|Apis mellifera complementary sex determiner protein. Length = 177 Score = 22.2 bits (45), Expect = 6.2 Identities = 9/18 (50%), Positives = 11/18 (61%) Frame = +1 Query: 643 VXYPVKGPVHVPAPYPVY 696 + Y + PV VP P PVY Sbjct: 105 INYIEQIPVPVPVPVPVY 122 >DQ325106-1|ABD14120.1| 177|Apis mellifera complementary sex determiner protein. Length = 177 Score = 22.2 bits (45), Expect = 6.2 Identities = 9/18 (50%), Positives = 11/18 (61%) Frame = +1 Query: 643 VXYPVKGPVHVPAPYPVY 696 + Y + PV VP P PVY Sbjct: 105 INYIEQIPVPVPVPVPVY 122 >AY350615-1|AAQ57657.1| 410|Apis mellifera complementary sex determiner protein. Length = 410 Score = 22.2 bits (45), Expect = 6.2 Identities = 9/18 (50%), Positives = 11/18 (61%) Frame = +1 Query: 643 VXYPVKGPVHVPAPYPVY 696 + Y + PV VP P PVY Sbjct: 338 INYIEQIPVPVPVPVPVY 355 >M29489-1|AAA27724.1| 109|Apis mellifera protein ( Bee homeobox-containing gene,partial cds, clone E60. ). Length = 109 Score = 21.8 bits (44), Expect = 8.2 Identities = 9/20 (45%), Positives = 11/20 (55%) Frame = +3 Query: 534 QTRPRQGICARTLPRLKRKF 593 + RPR L RLKR+F Sbjct: 20 EKRPRTAFSGEQLARLKREF 39 >DQ325107-1|ABD14121.1| 176|Apis mellifera complementary sex determiner protein. Length = 176 Score = 21.8 bits (44), Expect = 8.2 Identities = 9/18 (50%), Positives = 11/18 (61%) Frame = +1 Query: 643 VXYPVKGPVHVPAPYPVY 696 + Y + PV VP P PVY Sbjct: 105 INYIEQIPVPVPIPVPVY 122 >DQ011226-1|AAY63895.1| 471|Apis mellifera Rh-like protein protein. Length = 471 Score = 21.8 bits (44), Expect = 8.2 Identities = 12/50 (24%), Positives = 25/50 (50%) Frame = -2 Query: 598 NMNFLFKRGKVLAHIP*RGRVCRLGHVLGKAPSFRLGRVAVRELVPLTIS 449 N ++L R + A + + +G +LGK +L + + EL+ T++ Sbjct: 108 NKSYLSLRSLLSADVAVATPLISMGALLGKTTYMQLVFMGIVELIMFTVN 157 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 173,557 Number of Sequences: 438 Number of extensions: 4183 Number of successful extensions: 13 Number of sequences better than 10.0: 11 Number of HSP's better than 10.0 without gapping: 12 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 13 length of database: 146,343 effective HSP length: 57 effective length of database: 121,377 effective search space used: 27309825 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -