BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= FWDP01_FL5_O16 (832 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY137766-1|AAM94344.1| 78|Anopheles gambiae heat shock protein... 118 2e-28 DQ518577-1|ABF66619.1| 318|Anopheles gambiae putative secreted ... 24 6.5 >AY137766-1|AAM94344.1| 78|Anopheles gambiae heat shock protein 70 protein. Length = 78 Score = 118 bits (284), Expect = 2e-28 Identities = 56/64 (87%), Positives = 60/64 (93%) Frame = +2 Query: 512 NAVITVPAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDL 691 +AVITVPAYFNDSQRQATKDAG I+GLNV+RIINEPTAAA+AYGLDK GERNVLIFDL Sbjct: 1 DAVITVPAYFNDSQRQATKDAGAIAGLNVMRIINEPTAAALAYGLDKNLKGERNVLIFDL 60 Query: 692 GGGT 703 GGGT Sbjct: 61 GGGT 64 >DQ518577-1|ABF66619.1| 318|Anopheles gambiae putative secreted carbonic anhydrase protein. Length = 318 Score = 23.8 bits (49), Expect = 6.5 Identities = 14/42 (33%), Positives = 17/42 (40%) Frame = +2 Query: 701 TSTCHPYIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFVRSSR 826 TS HPYI G E + H D +NR H + R Sbjct: 107 TSGKHPYILGGKLENEYELEGLHFHWGDKNNRGAEHVLNDIR 148 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 894,370 Number of Sequences: 2352 Number of extensions: 18496 Number of successful extensions: 30 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 30 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 30 length of database: 563,979 effective HSP length: 64 effective length of database: 413,451 effective search space used: 87651612 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -