BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= FWDP01_FL5_O15 (848 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AB090812-1|BAC57899.1| 541|Anopheles gambiae gag-like protein p... 28 0.31 >AB090812-1|BAC57899.1| 541|Anopheles gambiae gag-like protein protein. Length = 541 Score = 28.3 bits (60), Expect = 0.31 Identities = 17/53 (32%), Positives = 24/53 (45%) Frame = +1 Query: 286 PSGQQRVRQGSQDPQQDPDARRERLRHPGLHQG*LGQNSDAHECAHHSEQRQR 444 P QQ+ +Q Q PQQ + R + HQG + AH +QRQ+ Sbjct: 254 PRSQQQPQQ-QQQPQQKQQQLQRRQQQQQQHQGQRYVPPQLRQQAHQQQQRQQ 305 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 796,469 Number of Sequences: 2352 Number of extensions: 16004 Number of successful extensions: 37 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 35 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 37 length of database: 563,979 effective HSP length: 64 effective length of database: 413,451 effective search space used: 90132318 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -