BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= FWDP01_FL5_O14 (826 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At2g38470.1 68415.m04725 WRKY family transcription factor contai... 34 0.13 At3g07760.2 68416.m00944 expressed protein 31 0.93 At3g07760.1 68416.m00943 expressed protein 31 0.93 At1g69830.1 68414.m08034 alpha-amylase, putative / 1,4-alpha-D-g... 29 3.7 At2g39930.1 68415.m04907 isoamylase, putative / starch debranchi... 29 5.0 At5g59130.1 68418.m07411 subtilase family protein contains simil... 28 8.7 At1g21320.1 68414.m02664 VQ motif-containing protein contains PF... 28 8.7 >At2g38470.1 68415.m04725 WRKY family transcription factor contains Pfam profile: PF03106 WRKY DNA -binding domain; Length = 519 Score = 33.9 bits (74), Expect = 0.13 Identities = 22/63 (34%), Positives = 30/63 (47%) Frame = -2 Query: 393 SMHSQATQNNTNSDQRKFTQKGSSAYFSTSSLVIPVNCRLLASSSIFASPFLWSPTTYFA 214 +M + T+ N N Q G ++ S L IP R A SSI SP L SP+T F+ Sbjct: 7 TMDNSRTRQNMNGSANWSQQSGRTSTSSLEDLEIP-KFRSFAPSSISISPSLVSPSTCFS 65 Query: 213 SDM 205 + Sbjct: 66 PSL 68 >At3g07760.2 68416.m00944 expressed protein Length = 125 Score = 31.1 bits (67), Expect = 0.93 Identities = 12/32 (37%), Positives = 19/32 (59%) Frame = +2 Query: 719 ENSTEPYTDYFIWTKEXXAXWVSKINMPAFNE 814 E+ EP D+FIWT E W+ +IN+ + + Sbjct: 4 EHPPEPL-DFFIWTVEDVGSWLEEINLGGYRQ 34 >At3g07760.1 68416.m00943 expressed protein Length = 125 Score = 31.1 bits (67), Expect = 0.93 Identities = 12/32 (37%), Positives = 19/32 (59%) Frame = +2 Query: 719 ENSTEPYTDYFIWTKEXXAXWVSKINMPAFNE 814 E+ EP D+FIWT E W+ +IN+ + + Sbjct: 4 EHPPEPL-DFFIWTVEDVGSWLEEINLGGYRQ 34 >At1g69830.1 68414.m08034 alpha-amylase, putative / 1,4-alpha-D-glucan glucanohydrolase, putative similar to SP|P17859 Alpha-amylase precursor (EC 3.2.1.1) (1,4-alpha-D-glucan glucanohydrolase) {Vigna mungo}, alpha-amylase [Malus x domestica] GI:7532799; contains Pfam profile PF00128: Alpha amylase, catalytic domain Length = 887 Score = 29.1 bits (62), Expect = 3.7 Identities = 12/35 (34%), Positives = 20/35 (57%) Frame = +2 Query: 581 YEVLDKRDTLDEFKILFNKIKKIGIRVIVDLIPNY 685 Y + + T+DE K K K+GI+V+ D + N+ Sbjct: 551 YNLNSRYGTIDELKDTVKKFHKVGIKVLGDAVLNH 585 >At2g39930.1 68415.m04907 isoamylase, putative / starch debranching enzyme, putative similar to isoamylase from [Solanum tuberosum] GI:27728145, [Triticum aestivum] GI:17932898, [Hordeum vulgare] GI:21314275, [Oryza sativa] GI:3252794; contains Pfam profiles PF00128: Alpha amylase catalytic domain, PF02922: Isoamylase N-terminal domain Length = 783 Score = 28.7 bits (61), Expect = 5.0 Identities = 12/26 (46%), Positives = 19/26 (73%) Frame = +2 Query: 608 LDEFKILFNKIKKIGIRVIVDLIPNY 685 ++EFKIL + K GI VI+D++ N+ Sbjct: 315 INEFKILVKEAHKRGIEVIMDVVLNH 340 >At5g59130.1 68418.m07411 subtilase family protein contains similarity to prepro-cucumisin GI:807698 from [Cucumis melo] Length = 732 Score = 27.9 bits (59), Expect = 8.7 Identities = 11/34 (32%), Positives = 19/34 (55%) Frame = +3 Query: 366 CSGWPGCACSPGLLQSLYAHPSAARPNPGHGTNS 467 C+G C+ L+ + + P AR + GHGT++ Sbjct: 167 CAGGKNFTCNNKLIGARHYSPGDARDSTGHGTHT 200 >At1g21320.1 68414.m02664 VQ motif-containing protein contains PF05678: VQ motif Length = 235 Score = 27.9 bits (59), Expect = 8.7 Identities = 12/39 (30%), Positives = 20/39 (51%), Gaps = 4/39 (10%) Frame = -1 Query: 391 HAQPGHPEQHEQRPTQVHPE----GIVSILQYLLSRHPS 287 H QP P+ H+Q P+Q P I ++ ++ HP+ Sbjct: 38 HPQPQPPQTHQQEPSQSRPPPGPVNIYTVTPRIIHTHPN 76 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 16,348,644 Number of Sequences: 28952 Number of extensions: 348328 Number of successful extensions: 1108 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 1066 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1108 length of database: 12,070,560 effective HSP length: 80 effective length of database: 9,754,400 effective search space used: 1892353600 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -