BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= FWDP01_FL5_O10 (836 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value S73225-1|AAB30811.1| 327|Tribolium castaneum protein ( Triboliu... 47 2e-07 X91618-1|CAA62821.1| 524|Tribolium castaneum hunchback protein. 24 1.7 L01615-1|AAA30095.1| 69|Tribolium castaneum zinc finger protei... 24 1.7 U77974-1|AAB36556.1| 276|Tribolium castaneum transcription fact... 23 3.0 DQ211693-1|ABB16909.1| 314|Tribolium castaneum dorsocross protein. 22 5.2 DQ138189-1|ABA03053.1| 162|Tribolium castaneum bursicon protein. 21 9.1 AM292349-1|CAL23161.1| 248|Tribolium castaneum gustatory recept... 21 9.1 >S73225-1|AAB30811.1| 327|Tribolium castaneum protein ( Tribolium castaneum homeodomainprotein mRNA, complete cds. ). Length = 327 Score = 46.8 bits (106), Expect = 2e-07 Identities = 29/61 (47%), Positives = 39/61 (63%) Frame = +2 Query: 548 EREISVDDGNSCCSDDTVLSVGNEAPVSNYEEKASQNTHQELTSFKHIQTHLSAISQLSQ 727 +RE D NSC SDDTVLSVGNE P ++T SFK+I++HL+AISQ++ Sbjct: 8 DRESPNIDHNSCSSDDTVLSVGNENP-------PPEDTP---LSFKNIESHLNAISQITN 57 Query: 728 N 730 + Sbjct: 58 S 58 >X91618-1|CAA62821.1| 524|Tribolium castaneum hunchback protein. Length = 524 Score = 23.8 bits (49), Expect = 1.7 Identities = 11/25 (44%), Positives = 15/25 (60%) Frame = +3 Query: 3 LES*LRDHAHNIPFKQNNCLIKTIN 77 LE LR+HA + PF+ N C +N Sbjct: 246 LEYHLRNHAGSKPFQCNKCDYTCVN 270 >L01615-1|AAA30095.1| 69|Tribolium castaneum zinc finger protein protein. Length = 69 Score = 23.8 bits (49), Expect = 1.7 Identities = 11/25 (44%), Positives = 15/25 (60%) Frame = +3 Query: 3 LES*LRDHAHNIPFKQNNCLIKTIN 77 LE LR+HA + PF+ N C +N Sbjct: 4 LEYHLRNHAGSKPFQCNKCDYTCVN 28 >U77974-1|AAB36556.1| 276|Tribolium castaneum transcription factor homolog protein. Length = 276 Score = 23.0 bits (47), Expect = 3.0 Identities = 9/17 (52%), Positives = 10/17 (58%) Frame = +3 Query: 621 HPYPTTKRKPARIPTKN 671 HPYP PA IP +N Sbjct: 177 HPYPNFGVPPAGIPLQN 193 >DQ211693-1|ABB16909.1| 314|Tribolium castaneum dorsocross protein. Length = 314 Score = 22.2 bits (45), Expect = 5.2 Identities = 10/23 (43%), Positives = 14/23 (60%) Frame = +2 Query: 488 NTPNFDDRNTESVSPVVEVNERE 556 ++PN T S P +EVNER+ Sbjct: 219 DSPNSKKSATPSPPPQLEVNERK 241 >DQ138189-1|ABA03053.1| 162|Tribolium castaneum bursicon protein. Length = 162 Score = 21.4 bits (43), Expect = 9.1 Identities = 15/49 (30%), Positives = 22/49 (44%) Frame = -1 Query: 356 LDLSCLSCSESMDRHRSGLGS*CPAYGRIRRPFSFSVTPSYHLNFIVQP 210 ++ SC+ C ES +R S + CP R F VT L + +P Sbjct: 83 MERSCMCCQESGEREAS-VSLFCPKAKPGERKF-IKVTTKAPLECMCRP 129 >AM292349-1|CAL23161.1| 248|Tribolium castaneum gustatory receptor candidate 28 protein. Length = 248 Score = 21.4 bits (43), Expect = 9.1 Identities = 12/46 (26%), Positives = 20/46 (43%) Frame = -2 Query: 640 FVVGYGCLVSN*QHGVVATARITIVHAYFSFIHFNNGTYTLCVSVI 503 FV+G C++ G++ V F F+HF T+ V+ Sbjct: 79 FVMGLFCILKFALDGLMLDKTGICVSNVFDFVHFYYPVATMSFYVL 124 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 199,375 Number of Sequences: 336 Number of extensions: 4768 Number of successful extensions: 19 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 17 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 18 length of database: 122,585 effective HSP length: 56 effective length of database: 103,769 effective search space used: 23036718 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -