BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= FWDP01_FL5_O10 (836 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At3g59490.1 68416.m06638 expressed protein 35 0.077 At1g34630.1 68414.m04305 expressed protein 34 0.13 At1g08730.1 68414.m00969 myosin heavy chain (PCR43) identical to... 33 0.18 At1g54560.1 68414.m06222 myosin, putative similar to myosin GI:4... 32 0.54 At1g01790.1 68414.m00098 K+ efflux antiporter, putative (KEA1) i... 31 0.95 At4g00920.1 68417.m00125 COP1-interacting protein-related simila... 29 3.8 At1g49600.1 68414.m05561 RNA-binding protein 47 (RBP47), putativ... 29 5.1 At4g02880.1 68417.m00388 expressed protein 28 6.7 At3g49390.1 68416.m05399 RNA-binding protein, putative RNA-bindi... 28 6.7 At2g46400.1 68415.m05775 WRKY family transcription factor 28 6.7 At1g74950.1 68414.m08697 expressed protein 28 6.7 At3g24460.1 68416.m03069 TMS membrane family protein / tumour di... 28 8.8 At1g67120.1 68414.m07636 midasin-related similar to Midasin (MID... 28 8.8 >At3g59490.1 68416.m06638 expressed protein Length = 243 Score = 34.7 bits (76), Expect = 0.077 Identities = 16/48 (33%), Positives = 27/48 (56%) Frame = +2 Query: 467 STEKLLENTPNFDDRNTESVSPVVEVNEREISVDDGNSCCSDDTVLSV 610 S +KL +T DD NT++ + + E N + S+ SCC DT +++ Sbjct: 137 SIQKLFSSTFPLDDSNTDTTTVLDEANSSQTSLCIDLSCCLQDTKVTI 184 >At1g34630.1 68414.m04305 expressed protein Length = 481 Score = 33.9 bits (74), Expect = 0.13 Identities = 13/38 (34%), Positives = 23/38 (60%) Frame = -1 Query: 425 ARCGWRKRMNGCLCLPISHRRGTLDLSCLSCSESMDRH 312 +RCG + + G +C P++ + G L L CLS S+ + + Sbjct: 185 SRCGIKSKRFGTICKPLTWKHGDLFLMCLSSSQILSAY 222 >At1g08730.1 68414.m00969 myosin heavy chain (PCR43) identical to myosin heavy chain PCR43 (PIR:T00727) [Arabidopsis thaliana]; similar to ESTs gb|R30087 and gb|AA394762 Length = 1538 Score = 33.5 bits (73), Expect = 0.18 Identities = 26/76 (34%), Positives = 37/76 (48%), Gaps = 4/76 (5%) Frame = +2 Query: 416 HNVLKKERDNSSPD--NVFSTEKLLE-NTPNFDDR-NTESVSPVVEVNEREISVDDGNSC 583 H KK D S D V S ++L +T +DD+ T SVSP V N R + +D N+ Sbjct: 1427 HQKPKKTLDEISHDLCPVLSIQQLYRISTMYWDDKYGTHSVSPDVIANMRVLMTEDSNNA 1486 Query: 584 CSDDTVLSVGNEAPVS 631 S+ +L + P S Sbjct: 1487 VSNSFLLDDDSSIPFS 1502 >At1g54560.1 68414.m06222 myosin, putative similar to myosin GI:433663 from [Arabidopsis thaliana] Length = 1529 Score = 31.9 bits (69), Expect = 0.54 Identities = 25/76 (32%), Positives = 37/76 (48%), Gaps = 4/76 (5%) Frame = +2 Query: 416 HNVLKKERDNSSPD--NVFSTEKLLE-NTPNFDDR-NTESVSPVVEVNEREISVDDGNSC 583 H KK D S + V S ++L +T +DD+ T SVSP V N R + +D N+ Sbjct: 1418 HQKPKKTLDEISHELCPVLSIQQLYRISTMYWDDKYGTHSVSPDVIANMRVLMTEDSNNA 1477 Query: 584 CSDDTVLSVGNEAPVS 631 S+ +L + P S Sbjct: 1478 VSNSFLLDDDSSIPFS 1493 >At1g01790.1 68414.m00098 K+ efflux antiporter, putative (KEA1) identical to GB:AAD01191 GI:4101473 from [ Arabidopsis thaliana]; Monovalent cation:proton antiporter family 2 (CPA2 family) member, PMID:11500563 Length = 618 Score = 31.1 bits (67), Expect = 0.95 Identities = 28/93 (30%), Positives = 42/93 (45%) Frame = -2 Query: 679 GGQFLVGILAGFLFVVGYGCLVSN*QHGVVATARITIVHAYFSFIHFNNGTYTLCVSVIE 500 GG ++G LA + + YG + HG A A +V F+ FN G + Sbjct: 36 GGSPVLGYLAAGILIGPYGLSIIRNVHGTRAIAEFGVV-----FLLFNIGLELSVERLSS 90 Query: 499 IRCILQELFRRKDIVRAAVVPLLLKHVVDGERG 401 ++ + L + +V AAVV LL H V G+ G Sbjct: 91 MKKYVFGLGSAQVLVTAAVVG-LLAHYVAGQAG 122 >At4g00920.1 68417.m00125 COP1-interacting protein-related similar to COP1-interacting protein 4 (CIP4) [Arabidopsis thaliana] GI:13160646 Length = 314 Score = 29.1 bits (62), Expect = 3.8 Identities = 17/52 (32%), Positives = 25/52 (48%), Gaps = 2/52 (3%) Frame = +2 Query: 485 ENTPNFDD--RNTESVSPVVEVNEREISVDDGNSCCSDDTVLSVGNEAPVSN 634 EN + DD R E ++ +V I+ DDG S+ S G + PV+N Sbjct: 184 ENESHKDDDVRVVEDINQSADVENEGINKDDGVDATSESFPNSTGEKKPVTN 235 >At1g49600.1 68414.m05561 RNA-binding protein 47 (RBP47), putative similar to DNA binding protein ACBF GB:U90212 GI:1899187 from [Nicotiana tabacum] Length = 445 Score = 28.7 bits (61), Expect = 5.1 Identities = 13/34 (38%), Positives = 19/34 (55%) Frame = -1 Query: 554 LFHSLQQRDLHSLCFCHRNSVYSPRAFPSKRHCQ 453 L H + + LH+ CF H N V S + +K+ CQ Sbjct: 126 LLHWMDETYLHT-CFSHTNEVSSVKVIRNKQTCQ 158 >At4g02880.1 68417.m00388 expressed protein Length = 552 Score = 28.3 bits (60), Expect = 6.7 Identities = 14/35 (40%), Positives = 21/35 (60%) Frame = +2 Query: 470 TEKLLENTPNFDDRNTESVSPVVEVNEREISVDDG 574 TEK LE + + ++ + SP VNER+ +DDG Sbjct: 508 TEKPLEASYETPEASSNNKSPKASVNERKELLDDG 542 >At3g49390.1 68416.m05399 RNA-binding protein, putative RNA-binding protein RBP37, Arabidopsis thaliana, PIR:T04196 Length = 353 Score = 28.3 bits (60), Expect = 6.7 Identities = 13/36 (36%), Positives = 20/36 (55%) Frame = +2 Query: 440 DNSSPDNVFSTEKLLENTPNFDDRNTESVSPVVEVN 547 D+ SP + ST +++TP DDR E+ V +N Sbjct: 38 DDQSPKSDSSTPLTIDSTPETDDRINETAQKVQTLN 73 >At2g46400.1 68415.m05775 WRKY family transcription factor Length = 295 Score = 28.3 bits (60), Expect = 6.7 Identities = 19/55 (34%), Positives = 26/55 (47%), Gaps = 2/55 (3%) Frame = +2 Query: 419 NVLKK--ERDNSSPDNVFSTEKLLENTPNFDDRNTESVSPVVEVNEREISVDDGN 577 N+LK+ E D NVF K+ E +NTE V V + S+DDG+ Sbjct: 60 NILKRSLEIDGKDSKNVFKKRKVSE-------KNTEKVKVFVATEQENGSIDDGH 107 >At1g74950.1 68414.m08697 expressed protein Length = 249 Score = 28.3 bits (60), Expect = 6.7 Identities = 11/32 (34%), Positives = 15/32 (46%) Frame = +1 Query: 688 HTNTLERHIAAEPKHECGPTAAITXESINPNP 783 H+ ++ IA+ P C P E I PNP Sbjct: 165 HSAYSQKEIASSPNPVCSPAKTAAQEPIQPNP 196 >At3g24460.1 68416.m03069 TMS membrane family protein / tumour differentially expressed (TDE) family protein contains Pfam domain, PF03348: TMS membrane protein/tumour differentially expressed protein (TDE) Length = 409 Score = 27.9 bits (59), Expect = 8.8 Identities = 18/52 (34%), Positives = 26/52 (50%), Gaps = 3/52 (5%) Frame = -2 Query: 574 TIVHAYFSFIHFNNGTYTL--CVSVIEIRCILQELFR-RKDIVRAAVVPLLL 428 +I+H Y HF G + L +SVI L E ++ +KD R V +LL Sbjct: 143 SIIHLYGEIAHFGAGVFLLIQLISVISFIQWLNECYQSQKDAERCRVYVMLL 194 >At1g67120.1 68414.m07636 midasin-related similar to Midasin (MIDAS-containing protein) (Swiss-Prot:Q12019) [Saccharomyces cerevisiae]; similar to Midasin (MIDAS-containing protein) (Swiss-Prot:Q9NU22) [Homo sapiens]; contains Prosite PS00017: ATP/GTP-binding site motif A (P-loop) Length = 5336 Score = 27.9 bits (59), Expect = 8.8 Identities = 21/87 (24%), Positives = 34/87 (39%), Gaps = 2/87 (2%) Frame = +2 Query: 416 HNVLKKERDNSSPDNVFSTEKLLENTPNFDDRNTESVSPVVEVNEREISVDD--GNSCCS 589 H KKE + D+V K +E + FD + E E E S D+ N Sbjct: 4514 HGTDKKEEEEKEQDDVLGKNKGIEMSDEFDGKEYSVSEDEEEDKEDEGSEDEPLDNGIGD 4573 Query: 590 DDTVLSVGNEAPVSNYEEKASQNTHQE 670 + +E P + EE +N +++ Sbjct: 4574 VGSDAEKADEKPWNKDEEDEEENMNEK 4600 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 18,308,643 Number of Sequences: 28952 Number of extensions: 398927 Number of successful extensions: 1210 Number of sequences better than 10.0: 13 Number of HSP's better than 10.0 without gapping: 1167 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1210 length of database: 12,070,560 effective HSP length: 80 effective length of database: 9,754,400 effective search space used: 1931371200 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -