BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= FWDP01_FL5_O09 (835 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AB047034-1|BAB64310.1| 1598|Apis mellifera mblk-1 protein. 24 2.0 DQ435333-1|ABD92648.1| 135|Apis mellifera OBP16 protein. 23 3.5 DQ869053-1|ABJ09600.1| 459|Apis mellifera capa-like receptor pr... 23 4.6 AY336529-1|AAQ02340.1| 712|Apis mellifera transferrin protein. 23 4.6 AY336528-1|AAQ02339.1| 712|Apis mellifera transferrin protein. 23 4.6 AY217097-1|AAO39761.1| 712|Apis mellifera transferrin protein. 23 4.6 DQ435334-1|ABD92649.1| 135|Apis mellifera OBP17 protein. 22 6.1 AB264333-1|BAF44088.1| 36|Apis mellifera ecdysone-induced prot... 22 8.0 >AB047034-1|BAB64310.1| 1598|Apis mellifera mblk-1 protein. Length = 1598 Score = 23.8 bits (49), Expect = 2.0 Identities = 8/26 (30%), Positives = 16/26 (61%) Frame = +2 Query: 668 YPHHPHNPXSTLTVLSWSTMKPSMTS 745 +PH P P +T+T ++ +T + T+ Sbjct: 647 HPHEPGAPATTITTITTTTTTTTTTT 672 >DQ435333-1|ABD92648.1| 135|Apis mellifera OBP16 protein. Length = 135 Score = 23.0 bits (47), Expect = 3.5 Identities = 9/47 (19%), Positives = 22/47 (46%) Frame = -2 Query: 831 EXVXEXTXCPMRRFRLV*VGRSMSRXXAADVIDGFIVDHESTVRVLQ 691 E V C M++F +V + + D++ + D+E+ +++ Sbjct: 57 ENVQSYVECMMKKFNVVDENGNFNEKNTRDIVQAVLDDNETDQLIVE 103 >DQ869053-1|ABJ09600.1| 459|Apis mellifera capa-like receptor protein. Length = 459 Score = 22.6 bits (46), Expect = 4.6 Identities = 8/10 (80%), Positives = 9/10 (90%) Frame = -1 Query: 172 PSRHYRSGLR 143 P RHYRSGL+ Sbjct: 139 PLRHYRSGLK 148 >AY336529-1|AAQ02340.1| 712|Apis mellifera transferrin protein. Length = 712 Score = 22.6 bits (46), Expect = 4.6 Identities = 11/27 (40%), Positives = 13/27 (48%) Frame = -1 Query: 235 RWSCLWASGHQAGCRAPGSKAPSRHYR 155 RW C W+ G C+A A SR R Sbjct: 387 RW-CTWSEGDLEKCKALTRAAYSRDVR 412 >AY336528-1|AAQ02339.1| 712|Apis mellifera transferrin protein. Length = 712 Score = 22.6 bits (46), Expect = 4.6 Identities = 11/27 (40%), Positives = 13/27 (48%) Frame = -1 Query: 235 RWSCLWASGHQAGCRAPGSKAPSRHYR 155 RW C W+ G C+A A SR R Sbjct: 387 RW-CTWSEGDLEKCKALTRAAYSRDVR 412 >AY217097-1|AAO39761.1| 712|Apis mellifera transferrin protein. Length = 712 Score = 22.6 bits (46), Expect = 4.6 Identities = 11/27 (40%), Positives = 13/27 (48%) Frame = -1 Query: 235 RWSCLWASGHQAGCRAPGSKAPSRHYR 155 RW C W+ G C+A A SR R Sbjct: 387 RW-CTWSEGDLEKCKALTRAAYSRDVR 412 >DQ435334-1|ABD92649.1| 135|Apis mellifera OBP17 protein. Length = 135 Score = 22.2 bits (45), Expect = 6.1 Identities = 9/41 (21%), Positives = 21/41 (51%) Frame = -2 Query: 831 EXVXEXTXCPMRRFRLV*VGRSMSRXXAADVIDGFIVDHES 709 E V C M++F +V + + ++D++ + D+E+ Sbjct: 57 ENVLLFIECTMKKFNVVDENANFNEKISSDIVRAVLNDNEA 97 >AB264333-1|BAF44088.1| 36|Apis mellifera ecdysone-induced protein 75 protein. Length = 36 Score = 21.8 bits (44), Expect = 8.0 Identities = 10/25 (40%), Positives = 16/25 (64%) Frame = +2 Query: 206 MARCPQTRPSGVETILSTLSSARPE 280 +A+ P + T+ ST+SSA+PE Sbjct: 7 VAQLPHHLSPNMPTMDSTVSSAKPE 31 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 230,646 Number of Sequences: 438 Number of extensions: 5379 Number of successful extensions: 13 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 13 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 13 length of database: 146,343 effective HSP length: 57 effective length of database: 121,377 effective search space used: 26702940 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -