BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= FWDP01_FL5_O07 (858 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF444780-1|AAL37901.1| 1152|Anopheles gambiae Toll protein. 25 2.9 CR954257-14|CAJ14165.1| 1726|Anopheles gambiae BEL12_AG transpos... 24 5.1 >AF444780-1|AAL37901.1| 1152|Anopheles gambiae Toll protein. Length = 1152 Score = 25.0 bits (52), Expect = 2.9 Identities = 9/16 (56%), Positives = 11/16 (68%) Frame = -1 Query: 549 PSTAILHSVSSCNCFI 502 PSTAI H + C C+I Sbjct: 660 PSTAIRHCPAPCRCYI 675 >CR954257-14|CAJ14165.1| 1726|Anopheles gambiae BEL12_AG transposon polyprotein protein. Length = 1726 Score = 24.2 bits (50), Expect = 5.1 Identities = 12/51 (23%), Positives = 25/51 (49%) Frame = +1 Query: 460 IQLCGKTIRSKRKHYEAITRRHTVQDGCTRQGLNERQAKRXRLRQSLDPKY 612 + +C + R+ + E I R+H + C R+G + R+ + + Q K+ Sbjct: 353 LHVCERFERASVINREEIVRKHGLCFNCLRKGHSARECRSTYVCQQCKRKH 403 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 738,865 Number of Sequences: 2352 Number of extensions: 12799 Number of successful extensions: 38 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 37 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 38 length of database: 563,979 effective HSP length: 64 effective length of database: 413,451 effective search space used: 91372671 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -