BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= FWDP01_FL5_O05 (855 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AF452568-1|AAL57830.1| 243|Tribolium castaneum homeodomain tran... 24 1.3 AF321227-5|AAK16425.1| 292|Tribolium castaneum Zen2 protein. 24 1.3 AF317551-1|AAG39634.1| 312|Tribolium castaneum distal-less prot... 23 4.1 EF592537-1|ABQ95983.1| 593|Tribolium castaneum beta-N-acetylglu... 22 5.4 >AF452568-1|AAL57830.1| 243|Tribolium castaneum homeodomain transcription factor Zen2 protein. Length = 243 Score = 24.2 bits (50), Expect = 1.3 Identities = 10/28 (35%), Positives = 17/28 (60%) Frame = +3 Query: 126 NSYVTPKKLLNHSIIQPKMYSNKDAANP 209 N VTPK N + + P+ S+ ++A+P Sbjct: 146 NKVVTPKTSPNEASMSPQSTSSNNSASP 173 >AF321227-5|AAK16425.1| 292|Tribolium castaneum Zen2 protein. Length = 292 Score = 24.2 bits (50), Expect = 1.3 Identities = 10/28 (35%), Positives = 17/28 (60%) Frame = +3 Query: 126 NSYVTPKKLLNHSIIQPKMYSNKDAANP 209 N VTPK N + + P+ S+ ++A+P Sbjct: 166 NKVVTPKTSPNEASMSPQSTSSNNSASP 193 >AF317551-1|AAG39634.1| 312|Tribolium castaneum distal-less protein. Length = 312 Score = 22.6 bits (46), Expect = 4.1 Identities = 15/56 (26%), Positives = 25/56 (44%), Gaps = 1/56 (1%) Frame = +2 Query: 287 GSAMDSYERSCCHSGTGATSTQTRCRGRRSPHGGGKYRKQHR-CTVASRCRVELIN 451 G + SY +C S +C P GGGK +K + T+ S +++ +N Sbjct: 86 GYHLGSYAANCPPS----PKDDEKCLSLERPSGGGKGKKMRKPRTIYSSLQLQQLN 137 >EF592537-1|ABQ95983.1| 593|Tribolium castaneum beta-N-acetylglucosaminidase NAG2 protein. Length = 593 Score = 22.2 bits (45), Expect = 5.4 Identities = 9/23 (39%), Positives = 14/23 (60%) Frame = -1 Query: 465 RPRNSLMSSTLHLEATVHRCCFR 397 R R L++ +H EA V R C++ Sbjct: 565 RHRERLVARGIHAEALVPRWCYQ 587 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 197,928 Number of Sequences: 336 Number of extensions: 4549 Number of successful extensions: 9 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 9 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 9 length of database: 122,585 effective HSP length: 56 effective length of database: 103,769 effective search space used: 23659332 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -