BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= FWDP01_FL5_O04 (998 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 04_03_0689 + 18746735-18748296,18748401-18748485 29 4.4 >04_03_0689 + 18746735-18748296,18748401-18748485 Length = 548 Score = 29.5 bits (63), Expect = 4.4 Identities = 15/54 (27%), Positives = 25/54 (46%) Frame = +2 Query: 278 NRKXRLXXKILXQNVPXLIPXSQXYXXLIXFXLKLNATXNAQTVSXXQKCXXTP 439 N+K +L K L V L+P S Y L+ F +++A + + V + P Sbjct: 151 NKKRKLPEKQLPDRVAALLPESALYTQLLEFESRVDAALHRKKVDIQEALKSPP 204 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 8,431,612 Number of Sequences: 37544 Number of extensions: 61955 Number of successful extensions: 122 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 121 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 122 length of database: 14,793,348 effective HSP length: 82 effective length of database: 11,714,740 effective search space used: 2928685000 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -