BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= FWDP01_FL5_O02 (821 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AY661557-1|AAT74557.1| 411|Apis mellifera yellow-f-like protein... 27 0.16 AF084556-1|AAC71015.1| 652|Apis mellifera pipsqueak protein. 26 0.48 AJ968562-1|CAI91546.1| 998|Apis mellifera protein ( Apis mellif... 24 1.5 AB047034-1|BAB64310.1| 1598|Apis mellifera mblk-1 protein. 23 2.6 DQ026034-1|AAY87893.1| 569|Apis mellifera nicotinic acetylcholi... 22 6.0 DQ026033-1|AAY87892.1| 569|Apis mellifera nicotinic acetylcholi... 22 6.0 DQ026032-1|AAY87891.1| 566|Apis mellifera nicotinic acetylcholi... 22 6.0 AY686596-1|AAT96374.1| 1946|Apis mellifera Dscam protein. 22 7.9 >AY661557-1|AAT74557.1| 411|Apis mellifera yellow-f-like protein protein. Length = 411 Score = 27.5 bits (58), Expect = 0.16 Identities = 8/23 (34%), Positives = 17/23 (73%) Frame = +2 Query: 398 VDSVLDVVRKEAESCDCLQGIPT 466 +DS+++++R ++CD L G+ T Sbjct: 106 IDSIINIIRVRVDACDRLWGVDT 128 >AF084556-1|AAC71015.1| 652|Apis mellifera pipsqueak protein. Length = 652 Score = 25.8 bits (54), Expect = 0.48 Identities = 18/61 (29%), Positives = 27/61 (44%), Gaps = 3/61 (4%) Frame = +2 Query: 338 GQSGAGNNWAKGHYTEGAELVDSVLDVVRKEAES---CDCLQGIPTDTLARRRHRFRYGH 508 G SG ++ G + E +D+ L+ +R S GIP+ TL +R HR Sbjct: 396 GHSGQSSSHHHGSKSWTQEDMDAALEALRNHDMSLTKASATFGIPSTTLWQRAHRLGIDT 455 Query: 509 P 511 P Sbjct: 456 P 456 >AJ968562-1|CAI91546.1| 998|Apis mellifera protein ( Apis mellifera ORF for hypotheticalprotein. ). Length = 998 Score = 24.2 bits (50), Expect = 1.5 Identities = 12/27 (44%), Positives = 17/27 (62%) Frame = -2 Query: 127 LPELSSDLVAALTSLDMYDFPHFVLFM 47 L E + +L AL+S++ F HFVL M Sbjct: 870 LVEFALELKKALSSINEQSFNHFVLKM 896 >AB047034-1|BAB64310.1| 1598|Apis mellifera mblk-1 protein. Length = 1598 Score = 23.4 bits (48), Expect = 2.6 Identities = 12/37 (32%), Positives = 19/37 (51%), Gaps = 1/37 (2%) Frame = -2 Query: 358 VAGAGLSEDEVVRTEDLSERSRADR-VHGAGLQVDED 251 ++ AG +++ R +RS +R VH G Q D D Sbjct: 1403 ISRAGSRDEDSTRDSTKLDRSSREREVHNGGQQEDRD 1439 >DQ026034-1|AAY87893.1| 569|Apis mellifera nicotinic acetylcholine receptor alpha4subunit protein. Length = 569 Score = 22.2 bits (45), Expect = 6.0 Identities = 11/34 (32%), Positives = 18/34 (52%), Gaps = 1/34 (2%) Frame = +2 Query: 713 IHTHIRRPEPPGVADHVRRDXVXAVPR-TAERRP 811 ++ H R P+ +A V+R + +PR RRP Sbjct: 329 LNVHFRSPQTHKMAPWVKRVFIHILPRLLVMRRP 362 >DQ026033-1|AAY87892.1| 569|Apis mellifera nicotinic acetylcholine receptor alpha4subunit protein. Length = 569 Score = 22.2 bits (45), Expect = 6.0 Identities = 11/34 (32%), Positives = 18/34 (52%), Gaps = 1/34 (2%) Frame = +2 Query: 713 IHTHIRRPEPPGVADHVRRDXVXAVPR-TAERRP 811 ++ H R P+ +A V+R + +PR RRP Sbjct: 329 LNVHFRSPQTHKMAPWVKRVFIHILPRLLVMRRP 362 >DQ026032-1|AAY87891.1| 566|Apis mellifera nicotinic acetylcholine receptor alpha3subunit protein. Length = 566 Score = 22.2 bits (45), Expect = 6.0 Identities = 9/27 (33%), Positives = 15/27 (55%) Frame = +2 Query: 713 IHTHIRRPEPPGVADHVRRDXVXAVPR 793 ++ H R P+ +A VRR + +PR Sbjct: 325 LNVHFRSPQTHVMAPWVRRVFIHVLPR 351 >AY686596-1|AAT96374.1| 1946|Apis mellifera Dscam protein. Length = 1946 Score = 21.8 bits (44), Expect = 7.9 Identities = 9/26 (34%), Positives = 14/26 (53%) Frame = -3 Query: 483 RRASVSVGIPWRQSHDSASFRTTSKT 406 RR + G+P + HD+ TS+T Sbjct: 1072 RRQHTAEGVPEQPPHDTTCTTLTSQT 1097 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 217,555 Number of Sequences: 438 Number of extensions: 4252 Number of successful extensions: 12 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 12 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 12 length of database: 146,343 effective HSP length: 57 effective length of database: 121,377 effective search space used: 26217432 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -