BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= FWDP01_FL5_O01 (855 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 07_03_1481 + 26860051-26860104,26861114-26861143,26861714-26863174 72 7e-13 >07_03_1481 + 26860051-26860104,26861114-26861143,26861714-26863174 Length = 514 Score = 71.7 bits (168), Expect = 7e-13 Identities = 61/221 (27%), Positives = 76/221 (34%) Frame = +3 Query: 150 AXXVNNXPVPXXQTQXPXKNNXGPXAXTXRXXXNXFGQXXWRXKGAXPRGXXFLTKEIXL 329 A ++ P P P K + G R N +GQ KGA RG TK++ L Sbjct: 62 AATTSSTPQPPPPPPPPEKTHFGDLKDEDRIFTNLYGQHDPFLKGAMKRGDWHRTKDLVL 121 Query: 330 XGXXXXXXXXKXSXLXXXXXXXXXXXXXWSXXXNPSNGRPKXXVVNXXKGXPVXXKNRKX 509 G K S L WS S+GRP VVN + P K+R+ Sbjct: 122 KGADWIVNEMKKSGLRGRGGAGFPSGLKWSFMPKVSDGRPSYLVVNADESEPGTCKDREI 181 Query: 510 XLHNPXKLVEGXLFAGRPMGAQPXIXLXXXVXXXXNXXXCXLLLLXAXQXXPXXXKTLXG 689 H+P KL+EG L AG +G + N L K G Sbjct: 182 MRHDPHKLLEGCLIAG--VGMRASAAYIYIRGEYVNERLNLLKAREEAYAAGLLGKNACG 239 Query: 690 PGYXFXNFXXPGVXXLTXXXEGTAPLXSLXGQXXXPXXXTP 812 GY F G E TA L SL G+ P P Sbjct: 240 SGYDFDVHIHFGAGAYICGEE-TALLESLEGKQGKPRLKPP 279 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 11,380,535 Number of Sequences: 37544 Number of extensions: 116693 Number of successful extensions: 134 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 130 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 134 length of database: 14,793,348 effective HSP length: 81 effective length of database: 11,752,284 effective search space used: 2385713652 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -