BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= FWDP01_FL5_N20 (876 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY578805-1|AAT07310.1| 753|Anopheles gambiae medea protein. 24 5.3 AY330173-1|AAQ16279.1| 202|Anopheles gambiae odorant-binding pr... 24 5.3 AJ618917-1|CAF01996.1| 199|Anopheles gambiae putative odorant-b... 24 5.3 CR954256-3|CAJ14144.1| 659|Anopheles gambiae cyclin protein. 24 7.0 CR954256-2|CAJ14143.1| 295|Anopheles gambiae cyclin protein. 24 7.0 AJ439353-8|CAD27930.1| 1039|Anopheles gambiae putative DNA topoi... 23 9.2 >AY578805-1|AAT07310.1| 753|Anopheles gambiae medea protein. Length = 753 Score = 24.2 bits (50), Expect = 5.3 Identities = 13/34 (38%), Positives = 20/34 (58%) Frame = -1 Query: 264 LVPEVPVKRRLLNPQPFRQFACRQTVYADLVQQV 163 L E+P ++RLL+ QP ++ C Y +L QV Sbjct: 506 LAGELPGQQRLLSRQPAPEYWC-SVAYFELDTQV 538 >AY330173-1|AAQ16279.1| 202|Anopheles gambiae odorant-binding protein AgamOBP46 protein. Length = 202 Score = 24.2 bits (50), Expect = 5.3 Identities = 11/36 (30%), Positives = 19/36 (52%) Frame = +2 Query: 68 ITDKLVDILCLSVIKCQA*QSCSRIQ*SVPPWTC*T 175 I K+ +LC S++ A +C ++ P+TC T Sbjct: 4 IVGKVFLVLCGSLLVTGAPNTCGKLDLKTDPFTCCT 39 >AJ618917-1|CAF01996.1| 199|Anopheles gambiae putative odorant-binding protein OBPjj1 protein. Length = 199 Score = 24.2 bits (50), Expect = 5.3 Identities = 11/36 (30%), Positives = 19/36 (52%) Frame = +2 Query: 68 ITDKLVDILCLSVIKCQA*QSCSRIQ*SVPPWTC*T 175 I K+ +LC S++ A +C ++ P+TC T Sbjct: 4 IVGKVFLVLCGSLLVTGAPNTCGKLDLKTDPFTCCT 39 >CR954256-3|CAJ14144.1| 659|Anopheles gambiae cyclin protein. Length = 659 Score = 23.8 bits (49), Expect = 7.0 Identities = 11/26 (42%), Positives = 14/26 (53%) Frame = -1 Query: 453 TLERPRPAARAHGAIVLAVGEQRLPE 376 T P+P R +G IVL + LPE Sbjct: 31 TAAAPQPVQRPYGKIVLTLENCLLPE 56 >CR954256-2|CAJ14143.1| 295|Anopheles gambiae cyclin protein. Length = 295 Score = 23.8 bits (49), Expect = 7.0 Identities = 11/26 (42%), Positives = 14/26 (53%) Frame = -1 Query: 453 TLERPRPAARAHGAIVLAVGEQRLPE 376 T P+P R +G IVL + LPE Sbjct: 31 TAAAPQPVQRPYGKIVLTLENCLLPE 56 >AJ439353-8|CAD27930.1| 1039|Anopheles gambiae putative DNA topoisomerase protein. Length = 1039 Score = 23.4 bits (48), Expect = 9.2 Identities = 10/16 (62%), Positives = 11/16 (68%) Frame = -3 Query: 598 PSQRSQASSFPSHDVV 551 PS S SS+PS DVV Sbjct: 870 PSSNSSPSSYPSPDVV 885 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 824,878 Number of Sequences: 2352 Number of extensions: 16801 Number of successful extensions: 21 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 19 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 21 length of database: 563,979 effective HSP length: 64 effective length of database: 413,451 effective search space used: 93853377 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -