BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= FWDP01_FL5_N19 (857 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC24C9.11 |||MIF4G/MA4 domain protein|Schizosaccharomyces pomb... 27 3.4 SPAC24B11.07c |||ketopantoate reductase |Schizosaccharomyces pom... 26 7.9 >SPAC24C9.11 |||MIF4G/MA4 domain protein|Schizosaccharomyces pombe|chr 1|||Manual Length = 775 Score = 27.1 bits (57), Expect = 3.4 Identities = 16/48 (33%), Positives = 26/48 (54%), Gaps = 3/48 (6%) Frame = -2 Query: 229 TNAKMK*KSKIINCS---KFKRRAKLQKYVSGAARRTA*ALSVLRITM 95 TN K K+K+ N S KF+ +L+K++ R+ A LR+T+ Sbjct: 457 TNLKENKKTKVANASAQSKFEAVNQLKKFLGSLGNRSLNAREPLRVTL 504 >SPAC24B11.07c |||ketopantoate reductase |Schizosaccharomyces pombe|chr 1|||Manual Length = 561 Score = 25.8 bits (54), Expect = 7.9 Identities = 16/34 (47%), Positives = 19/34 (55%) Frame = +2 Query: 410 RSSRTSLLTYWIFLLQMLESARRGAEGHGRLMDP 511 R SR SL Y L+QM +S + EG GR DP Sbjct: 406 RRSRRSL--YSPSLMQMQQSLKSDYEGLGRTFDP 437 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 3,066,579 Number of Sequences: 5004 Number of extensions: 61722 Number of successful extensions: 126 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 122 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 126 length of database: 2,362,478 effective HSP length: 72 effective length of database: 2,002,190 effective search space used: 426466470 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -