BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= FWDP01_FL5_N18 (853 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_54858| Best HMM Match : DUF668 (HMM E-Value=4.9) 32 0.51 SB_25234| Best HMM Match : SMC_hinge (HMM E-Value=3.7e-28) 30 2.7 SB_46264| Best HMM Match : rve (HMM E-Value=1.9e-16) 29 4.8 SB_7976| Best HMM Match : ShTK (HMM E-Value=0.001) 28 8.4 SB_43382| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.4 SB_4695| Best HMM Match : SAM_1 (HMM E-Value=0.012) 28 8.4 >SB_54858| Best HMM Match : DUF668 (HMM E-Value=4.9) Length = 173 Score = 32.3 bits (70), Expect = 0.51 Identities = 11/29 (37%), Positives = 18/29 (62%) Frame = -1 Query: 454 SLSDSLGRLQGICVFHHQLVLIPSFPGAS 368 S+ D L RL G+C+FH +++ +F S Sbjct: 143 SMQDGLSRLSGMCIFHQPTIIVNNFKKTS 171 >SB_25234| Best HMM Match : SMC_hinge (HMM E-Value=3.7e-28) Length = 552 Score = 29.9 bits (64), Expect = 2.7 Identities = 26/110 (23%), Positives = 48/110 (43%), Gaps = 1/110 (0%) Frame = +1 Query: 286 MKSYQISRGSQETCK-DFYGLQWKPQKLKMHQGNSELGPIDDERRKFLEDALKSLTVNIA 462 + SY R +E C + + +L QG + R +++ +KSLT +A Sbjct: 113 LPSYNEYRAEEEQCTLRLSACEQRRTELYAKQGRKNQFSSKEARDNWIKKEMKSLTSTVA 172 Query: 463 EVLLNAIRILTNTERIRSIQFGEPLPGDVQAAFDNVLEYIDDIDTANDFY 612 + + TER+RS +F + L D++ D++ + I+ N Y Sbjct: 173 KKESQIQALQQETERLRS-EF-QRLETDIKERTDDLEQRRSSIEQNNKEY 220 >SB_46264| Best HMM Match : rve (HMM E-Value=1.9e-16) Length = 979 Score = 29.1 bits (62), Expect = 4.8 Identities = 17/59 (28%), Positives = 25/59 (42%) Frame = -1 Query: 814 YRHLTRASPCSXALE*VERSAXRTXRTSPGRTDCSDRAQXRTVLARGTGPSHFRFHSIL 638 + H+ + CS + VER+ + P C T+LA P H R H+IL Sbjct: 875 FTHILSSPLCSPSNGEVERAVGTVKKEKPSCPTCDS-----TILAESVRPLHRRLHTIL 928 >SB_7976| Best HMM Match : ShTK (HMM E-Value=0.001) Length = 277 Score = 28.3 bits (60), Expect = 8.4 Identities = 14/32 (43%), Positives = 19/32 (59%), Gaps = 2/32 (6%) Frame = +1 Query: 643 CYGSENEKVPCPSPVRSW-XELC-QNNPFCQE 732 C S + KV CP+ V++W +C NNP QE Sbjct: 39 CENSVDWKVECPNIVKNWGARVCISNNPHFQE 70 >SB_43382| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 861 Score = 28.3 bits (60), Expect = 8.4 Identities = 14/42 (33%), Positives = 28/42 (66%) Frame = +3 Query: 192 LTKYLSF*KMSSNNTQNNTIAGALTYPTRSQDEVLPNQPRQP 317 +T++L+F K +NN ++++ A+TY + +D+ L +PR P Sbjct: 2 ITRWLNFRKRRNNNCFSDSLDKAVTY-SSPKDDFLYARPRFP 42 >SB_4695| Best HMM Match : SAM_1 (HMM E-Value=0.012) Length = 1348 Score = 28.3 bits (60), Expect = 8.4 Identities = 18/51 (35%), Positives = 28/51 (54%) Frame = +1 Query: 388 ELGPIDDERRKFLEDALKSLTVNIAEVLLNAIRILTNTERIRSIQFGEPLP 540 E+G +D RK L +A+KSL V+ V NA + +E + S+ E +P Sbjct: 708 EIGVLDMSNRKILLEAVKSLPVHPQLVDSNAQSFSSASEWLGSLCLDEYVP 758 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 23,593,189 Number of Sequences: 59808 Number of extensions: 442616 Number of successful extensions: 915 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 832 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 914 length of database: 16,821,457 effective HSP length: 81 effective length of database: 11,977,009 effective search space used: 2419355818 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -