BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= FWDP01_FL5_N16 (846 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g49730.1 68418.m06158 ferric reductase-like transmembrane com... 35 0.059 At3g47570.1 68416.m05179 leucine-rich repeat transmembrane prote... 32 0.55 At4g12700.1 68417.m01994 expressed protein 30 2.2 At4g21640.1 68417.m03136 subtilase family protein similar to sub... 28 9.0 At3g60630.1 68416.m06784 scarecrow transcription factor family p... 28 9.0 >At5g49730.1 68418.m06158 ferric reductase-like transmembrane component family protein similar to ferric-chelate reductase (FRO1) [Pisum sativum] GI:15341529; contains Pfam profile PF01794: Ferric reductase like transmembrane componenent Length = 738 Score = 35.1 bits (77), Expect = 0.059 Identities = 18/42 (42%), Positives = 26/42 (61%) Frame = +2 Query: 47 IGFFSIIITLTEFFWKRNNITSCWEKKNLNGSFIGCVLSGAV 172 IGF S+I L F+ KR NIT+ W K L F+GC+++ + Sbjct: 577 IGFISMITLLDIFYIKRYNITTWWYKGLL---FVGCMVASVL 615 >At3g47570.1 68416.m05179 leucine-rich repeat transmembrane protein kinase, putative protein kinase Xa21 - Oryza sativa, PIR:A57676 Length = 1010 Score = 31.9 bits (69), Expect = 0.55 Identities = 17/39 (43%), Positives = 23/39 (58%) Frame = -2 Query: 557 LLITAPMISSPVFTLSKKCLNLAVLSTFRNVSNGGINAY 441 L++ M+S P+ T K LNL LS F N +GGI A+ Sbjct: 390 LILDQNMLSGPLPTSLGKLLNLRYLSLFSNRLSGGIPAF 428 >At4g12700.1 68417.m01994 expressed protein Length = 561 Score = 29.9 bits (64), Expect = 2.2 Identities = 20/56 (35%), Positives = 27/56 (48%) Frame = +1 Query: 418 TLVPEDNLYALMPPFETFLNVDKTARLRHFFDNVKTGELIIGAVINRTASGMMLKV 585 T PED L+ TFL + A L+ VKTGE + A N+TA G + + Sbjct: 47 TYEPEDPLFHPSDKITTFLTSNSNATLKSDDSIVKTGEDFMAA--NQTAFGGFINI 100 >At4g21640.1 68417.m03136 subtilase family protein similar to subtilase SP1 [Oryza sativa] GI:9957714 Length = 733 Score = 27.9 bits (59), Expect = 9.0 Identities = 11/31 (35%), Positives = 19/31 (61%) Frame = -2 Query: 494 LAVLSTFRNVSNGGINAYKLSSGTRVSVPLV 402 +++L+ + G N +KL SGT +S P+V Sbjct: 492 VSILAAVSPLDPGAFNGFKLHSGTSMSTPVV 522 >At3g60630.1 68416.m06784 scarecrow transcription factor family protein scarecrow-like 6, Arabidopsis thaliana, EMBL:AF036303 Length = 623 Score = 27.9 bits (59), Expect = 9.0 Identities = 11/37 (29%), Positives = 21/37 (56%) Frame = -3 Query: 316 CYDLGR*GAYVSTGIQQSXKAPTPILAKSSSPLSDSH 206 C+ + G T + S ++P+P ++ S++ LS SH Sbjct: 43 CFVVNNGGFSEPTSVLDSVRSPSPFVSSSTTTLSSSH 79 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 16,566,550 Number of Sequences: 28952 Number of extensions: 326406 Number of successful extensions: 836 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 804 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 834 length of database: 12,070,560 effective HSP length: 80 effective length of database: 9,754,400 effective search space used: 1960634400 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -