BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= FWDP01_FL5_N12 (842 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value EF625897-1|ABR45904.1| 684|Apis mellifera hexamerin protein. 23 3.5 EF591128-1|ABQ59246.1| 684|Apis mellifera hexamerin 70a protein. 23 3.5 DQ855482-1|ABH88169.1| 116|Apis mellifera chemosensory protein ... 23 4.7 AY898652-1|AAX83121.1| 349|Apis mellifera AKH receptor protein. 23 4.7 AJ973399-1|CAJ01446.1| 116|Apis mellifera hypothetical protein ... 23 4.7 DQ026037-1|AAY87896.1| 431|Apis mellifera nicotinic acetylcholi... 22 8.1 >EF625897-1|ABR45904.1| 684|Apis mellifera hexamerin protein. Length = 684 Score = 23.0 bits (47), Expect = 3.5 Identities = 7/23 (30%), Positives = 15/23 (65%) Frame = +2 Query: 605 EMENFGGQDQIQKHRLLANMYLL 673 ++ ++ G++ + H+LL N Y L Sbjct: 250 DLPDYRGEEYLYSHKLLLNRYYL 272 >EF591128-1|ABQ59246.1| 684|Apis mellifera hexamerin 70a protein. Length = 684 Score = 23.0 bits (47), Expect = 3.5 Identities = 7/23 (30%), Positives = 15/23 (65%) Frame = +2 Query: 605 EMENFGGQDQIQKHRLLANMYLL 673 ++ ++ G++ + H+LL N Y L Sbjct: 250 DLPDYRGEEYLYSHKLLLNRYYL 272 >DQ855482-1|ABH88169.1| 116|Apis mellifera chemosensory protein 1 protein. Length = 116 Score = 22.6 bits (46), Expect = 4.7 Identities = 7/18 (38%), Positives = 10/18 (55%) Frame = +3 Query: 558 CSACTQTQSENCRAQAKW 611 C CT+ Q +N A+W Sbjct: 75 CKKCTEIQKQNLDKLAEW 92 >AY898652-1|AAX83121.1| 349|Apis mellifera AKH receptor protein. Length = 349 Score = 22.6 bits (46), Expect = 4.7 Identities = 9/26 (34%), Positives = 14/26 (53%) Frame = -2 Query: 151 ILIHLPYHNCVRWFSRIHSFLKSPAF 74 I+ HL H V W+S+ +F P + Sbjct: 173 IVFHLETHPNVTWYSQCVTFNAFPTY 198 >AJ973399-1|CAJ01446.1| 116|Apis mellifera hypothetical protein protein. Length = 116 Score = 22.6 bits (46), Expect = 4.7 Identities = 7/18 (38%), Positives = 10/18 (55%) Frame = +3 Query: 558 CSACTQTQSENCRAQAKW 611 C CT+ Q +N A+W Sbjct: 75 CKKCTEIQKQNLDKLAEW 92 >DQ026037-1|AAY87896.1| 431|Apis mellifera nicotinic acetylcholine receptor alpha9subunit protein. Length = 431 Score = 21.8 bits (44), Expect = 8.1 Identities = 11/37 (29%), Positives = 18/37 (48%) Frame = -1 Query: 518 PNIKPWSPAPTSSSFLFSCTPAAMFGDCWSSASITLH 408 PN++P S +++ P M D W+S + LH Sbjct: 57 PNVRPISSHQIANNVTMQLLPKLMEFDDWTSV-MELH 92 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 241,274 Number of Sequences: 438 Number of extensions: 5325 Number of successful extensions: 19 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 19 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 19 length of database: 146,343 effective HSP length: 57 effective length of database: 121,377 effective search space used: 27067071 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -