BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= FWDP01_FL5_N09 (866 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 06_03_0105 + 16693771-16693780,16693833-16693876,16694274-166943... 30 2.8 02_05_0220 - 26885502-26885561,26885940-26886739,26887055-268874... 28 8.4 >06_03_0105 + 16693771-16693780,16693833-16693876,16694274-16694348, 16694548-16694784,16694880-16695050,16695137-16695250 Length = 216 Score = 29.9 bits (64), Expect = 2.8 Identities = 9/18 (50%), Positives = 12/18 (66%) Frame = -3 Query: 387 NWKCRCRPQTRRESCWVF 334 N+ CRCRP+ RR W + Sbjct: 5 NYVCRCRPENRRNKGWAY 22 >02_05_0220 - 26885502-26885561,26885940-26886739,26887055-26887421, 26887942-26888055,26888132-26888228,26889115-26889235, 26889306-26889390,26889494-26889643,26889871-26889987, 26890123-26890221,26890439-26890495,26890581-26890664, 26890759-26890828,26891015-26891169,26891557-26892095, 26892327-26892393,26892436-26892984,26893574-26893768, 26894485-26894569,26895822-26896441,26897154-26897486, 26897552-26897616,26897868-26897955,26898250-26898331, 26898720-26898796,26899152-26899256,26899496-26899630, 26900199-26900888,26901474-26902261,26902990-26904673 Length = 2825 Score = 28.3 bits (60), Expect = 8.4 Identities = 15/47 (31%), Positives = 22/47 (46%) Frame = -1 Query: 263 SYPVKVSHFSFSPVIDVVYQPSTNRYLHEVVHTEVGYWGVWIQQVLI 123 S P F + D++Y STN + + T + W WI +VLI Sbjct: 1085 SLPFASRAFQAHAIQDLLYLASTNNE-NRIALTSIAEWPEWILEVLI 1130 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 21,932,799 Number of Sequences: 37544 Number of extensions: 473455 Number of successful extensions: 1342 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 1303 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1342 length of database: 14,793,348 effective HSP length: 81 effective length of database: 11,752,284 effective search space used: 2432722788 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -