BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= FWDP01_FL5_N08 (860 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AJ439060-3|CAD27754.1| 1645|Anopheles gambiae hypothetical prote... 26 1.7 AJ438610-11|CAD27483.1| 765|Anopheles gambiae hypothetical prot... 26 1.7 AY324307-1|AAQ89692.1| 154|Anopheles gambiae insulin-like pepti... 23 9.0 >AJ439060-3|CAD27754.1| 1645|Anopheles gambiae hypothetical protein protein. Length = 1645 Score = 25.8 bits (54), Expect = 1.7 Identities = 14/40 (35%), Positives = 21/40 (52%) Frame = +3 Query: 378 DLLRSRPSHLLYQ*RNYFLMETFLRVKLWTMVLLRVLMRE 497 DLLR PS +++ M F +K W M LR++ R+ Sbjct: 345 DLLRKEPSFSAEWAKSFNKMSHFNSLKQWGMNRLRMMNRD 384 >AJ438610-11|CAD27483.1| 765|Anopheles gambiae hypothetical protein protein. Length = 765 Score = 25.8 bits (54), Expect = 1.7 Identities = 14/40 (35%), Positives = 21/40 (52%) Frame = +3 Query: 378 DLLRSRPSHLLYQ*RNYFLMETFLRVKLWTMVLLRVLMRE 497 DLLR PS +++ M F +K W M LR++ R+ Sbjct: 346 DLLRKEPSFSAEWAKSFNKMSHFNSLKQWGMNRLRMMNRD 385 >AY324307-1|AAQ89692.1| 154|Anopheles gambiae insulin-like peptide 1 precursor protein. Length = 154 Score = 23.4 bits (48), Expect = 9.0 Identities = 11/30 (36%), Positives = 15/30 (50%) Frame = +3 Query: 558 FIRKSDMLLKPTGRQEXHPQXDQAWHDYDR 647 F +KS+ LL E H D+ HD +R Sbjct: 67 FRKKSENLLMTLAGPETHQLLDELEHDVER 96 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 586,113 Number of Sequences: 2352 Number of extensions: 8447 Number of successful extensions: 24 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 20 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 24 length of database: 563,979 effective HSP length: 64 effective length of database: 413,451 effective search space used: 91786122 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -