BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= FWDP01_FL5_M23 (835 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC6F6.01 |||VIC sodium channel |Schizosaccharomyces pombe|chr ... 29 0.81 SPAC32A11.01 |mug8||conserved fungal protein|Schizosaccharomyces... 28 1.4 SPBC1539.01c |||mitochondrial ribosomal protein subunit L15|Schi... 27 2.5 SPAC3G9.12 |peg1|cls1|CLASP family microtubule-associated protei... 27 4.3 SPAP8A3.05 |||ski complex subunit Ski7 |Schizosaccharomyces pomb... 27 4.3 SPBC32H8.11 |mei4||meiotic forkhead transcription factor Mei4 |S... 26 5.7 SPBC887.10 |mcs4||two-component response regulator |Schizosaccha... 26 7.6 >SPAC6F6.01 |||VIC sodium channel |Schizosaccharomyces pombe|chr 1|||Manual Length = 1854 Score = 29.1 bits (62), Expect = 0.81 Identities = 15/48 (31%), Positives = 25/48 (52%) Frame = +1 Query: 1 YWVINSTYLLLNYYCIDFFVYVSILANEIHAYENKYIYQSRLWNCIKA 144 + + + YL + CIDFFV V++ N ++A + SR + KA Sbjct: 1004 FCITPNAYLRSTWNCIDFFVLVTLWIN-LYAVLTSHALLSRAFRAFKA 1050 >SPAC32A11.01 |mug8||conserved fungal protein|Schizosaccharomyces pombe|chr 1|||Manual Length = 720 Score = 28.3 bits (60), Expect = 1.4 Identities = 17/55 (30%), Positives = 25/55 (45%) Frame = -2 Query: 273 NCLRPPELACLVVHLPPPASSFWSTNITVIHFNN*STAAVLQCSFDTIP*TTLID 109 N L P + +S+F S++ T I N T + L CSFD + + ID Sbjct: 571 NTLPPTSQGATSTTVSSASSNFLSSSCTPIDDTNSVTGSTLSCSFDEMKLSDKID 625 >SPBC1539.01c |||mitochondrial ribosomal protein subunit L15|Schizosaccharomyces pombe|chr 2|||Manual Length = 210 Score = 27.5 bits (58), Expect = 2.5 Identities = 7/15 (46%), Positives = 13/15 (86%) Frame = +1 Query: 97 ENKYIYQSRLWNCIK 141 ENK++++S WNC++ Sbjct: 14 ENKFVFRSSSWNCVR 28 >SPAC3G9.12 |peg1|cls1|CLASP family microtubule-associated protein|Schizosaccharomyces pombe|chr 1|||Manual Length = 1462 Score = 26.6 bits (56), Expect = 4.3 Identities = 9/22 (40%), Positives = 16/22 (72%) Frame = +1 Query: 451 YNLDDMSYSLEEAENMDLRENI 516 Y++ D SYS+ E + ++REN+ Sbjct: 1096 YDIHDQSYSVHELHSENMRENV 1117 >SPAP8A3.05 |||ski complex subunit Ski7 |Schizosaccharomyces pombe|chr 1|||Manual Length = 695 Score = 26.6 bits (56), Expect = 4.3 Identities = 23/68 (33%), Positives = 33/68 (48%) Frame = +1 Query: 10 INSTYLLLNYYCIDFFVYVSILANEIHAYENKYIYQSRLWNCIKAAL*NCCRGLIVKMNN 189 I+S L+N I +++ +EI ENK+I L N I++ L C G+I K Sbjct: 397 ISSILQLMNGLSISSYMFAITKMDEIEWDENKFI---NLVNSIQSFLKESC-GIIEKSKF 452 Query: 190 GDISAPKG 213 IS KG Sbjct: 453 IPISGLKG 460 >SPBC32H8.11 |mei4||meiotic forkhead transcription factor Mei4 |Schizosaccharomyces pombe|chr 2|||Manual Length = 517 Score = 26.2 bits (55), Expect = 5.7 Identities = 31/114 (27%), Positives = 48/114 (42%), Gaps = 2/114 (1%) Frame = +1 Query: 67 SILANEIHAYENKYIYQSRLWNCIKAAL*NCCRGLIVKMNNGDISAPKGRGRGWQMNNQA 246 +I A+E YEN + SRL+ CR + +N G A G R +N Sbjct: 279 TIDAHESSLYEN--VNDSRLYEV------PACRNMA--LNTGYSDADPGYLRTSFRSNSH 328 Query: 247 RELRRPKAVSDEPKVDTSKSKLSADAK--EWYPANYTSQALPAYNTEPAPCRPS 402 L P + ++E V + +S + Y ++ ++P Y EP P RPS Sbjct: 329 NSL--PYSANEEEDVLQADFLVSQQSSMVSSYVSSRDPHSMPYYRREPIPLRPS 380 >SPBC887.10 |mcs4||two-component response regulator |Schizosaccharomyces pombe|chr 2|||Manual Length = 522 Score = 25.8 bits (54), Expect = 7.6 Identities = 21/91 (23%), Positives = 39/91 (42%) Frame = +1 Query: 229 QMNNQARELRRPKAVSDEPKVDTSKSKLSADAKEWYPANYTSQALPAYNTEPAPCRPSRP 408 Q +++A + R ++ + D S ++ A A+ P N S + + T+ + P Sbjct: 225 QPSDEAESITRKNSIGMSTRSDESTAEKLAKAEVATPTNSRSISHSSLYTKQSGTAGVLP 284 Query: 409 SVQGRLRQAQDQNPYNLDDMSYSLEEAENMD 501 +V + A NP D+S A+N D Sbjct: 285 AVNADIDAANRMNP----DISSQFPIADNKD 311 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 3,382,158 Number of Sequences: 5004 Number of extensions: 72116 Number of successful extensions: 195 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 184 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 195 length of database: 2,362,478 effective HSP length: 72 effective length of database: 2,002,190 effective search space used: 410448950 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -