BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= FWDP01_FL5_M23 (835 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AJ276428-1|CAB81934.1| 1322|Anopheles gambiae adhesive serine pr... 28 0.30 AJ302661-1|CAC35526.1| 128|Anopheles gambiae gSG8 protein protein. 24 6.6 AY748841-1|AAV28189.1| 158|Anopheles gambiae cytochrome P450 pr... 23 8.7 AF510719-1|AAP47148.1| 591|Anopheles gambiae ammonium transport... 23 8.7 AF444781-1|AAL37902.1| 1459|Anopheles gambiae Toll6 protein. 23 8.7 AF281078-2|AAF82132.1| 755|Anopheles gambiae vitellogenin 2 pro... 23 8.7 AF281078-1|AAF82131.1| 2051|Anopheles gambiae vitellogenin 1 pro... 23 8.7 >AJ276428-1|CAB81934.1| 1322|Anopheles gambiae adhesive serine protease protein. Length = 1322 Score = 28.3 bits (60), Expect = 0.30 Identities = 19/71 (26%), Positives = 33/71 (46%), Gaps = 2/71 (2%) Frame = +1 Query: 295 TSKSKLSADAKEWYPANYT--SQALPAYNTEPAPCRPSRPSVQGRLRQAQDQNPYNLDDM 468 TS+ S +YP++ SQ +PA P +PSRP++ +Q + P D Sbjct: 355 TSRPVASGPTSHYYPSHIPAGSQPVPAVVN---PQQPSRPTIPAPQQQTPPRQPPATGDR 411 Query: 469 SYSLEEAENMD 501 + + + E +D Sbjct: 412 APAHPDVEQID 422 >AJ302661-1|CAC35526.1| 128|Anopheles gambiae gSG8 protein protein. Length = 128 Score = 23.8 bits (49), Expect = 6.6 Identities = 9/18 (50%), Positives = 11/18 (61%) Frame = -1 Query: 259 AGARVPGCSFATPGLVLL 206 AG R P C + P LVL+ Sbjct: 88 AGLRQPACRYRVPSLVLV 105 >AY748841-1|AAV28189.1| 158|Anopheles gambiae cytochrome P450 protein. Length = 158 Score = 23.4 bits (48), Expect = 8.7 Identities = 13/28 (46%), Positives = 13/28 (46%) Frame = +1 Query: 343 NYTSQALPAYNTEPAPCRPSRPSVQGRL 426 NY PA EP RP R QGRL Sbjct: 126 NYDLSMSPALWDEPERFRPERFLQQGRL 153 >AF510719-1|AAP47148.1| 591|Anopheles gambiae ammonium transport-like protein protein. Length = 591 Score = 23.4 bits (48), Expect = 8.7 Identities = 11/37 (29%), Positives = 17/37 (45%) Frame = +1 Query: 505 RENIANLITVMCEITFDPGKFDTLCGPLVDSFASXLN 615 R + N + + DPG D L GP+ +F L+ Sbjct: 103 RGELNNPFVALGDFLIDPGVSDPLFGPIFAAFLFQLS 139 >AF444781-1|AAL37902.1| 1459|Anopheles gambiae Toll6 protein. Length = 1459 Score = 23.4 bits (48), Expect = 8.7 Identities = 10/29 (34%), Positives = 16/29 (55%) Frame = -1 Query: 733 LRXATDRTXDTNELHCTGNSFAD*LINNG 647 L+ D+ D NE+ C+ N+ L +NG Sbjct: 973 LQSNADKIVDANEISCSYNNATSILRDNG 1001 >AF281078-2|AAF82132.1| 755|Anopheles gambiae vitellogenin 2 protein. Length = 755 Score = 23.4 bits (48), Expect = 8.7 Identities = 14/49 (28%), Positives = 17/49 (34%) Frame = +1 Query: 304 SKLSADAKEWYPANYTSQALPAYNTEPAPCRPSRPSVQGRLRQAQDQNP 450 S+L D + Y P NT + PSV G D NP Sbjct: 157 SQLQLDTQGAYVIKSEFNQFPENNTLTGVYKTMEPSVTGECETLYDVNP 205 >AF281078-1|AAF82131.1| 2051|Anopheles gambiae vitellogenin 1 protein. Length = 2051 Score = 23.4 bits (48), Expect = 8.7 Identities = 14/49 (28%), Positives = 17/49 (34%) Frame = +1 Query: 304 SKLSADAKEWYPANYTSQALPAYNTEPAPCRPSRPSVQGRLRQAQDQNP 450 S+L D + Y P NT + PSV G D NP Sbjct: 157 SQLQLDTQGAYVIKSEFNQFPENNTLTGVYKTMEPSVTGECETLYDVNP 205 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 876,117 Number of Sequences: 2352 Number of extensions: 17922 Number of successful extensions: 39 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 38 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 39 length of database: 563,979 effective HSP length: 64 effective length of database: 413,451 effective search space used: 88065063 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -