BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= FWDP01_FL5_M19 (833 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value M93690-1|AAA29364.1| 613|Anopheles gambiae ORF1 protein. 28 0.40 AJ535204-1|CAD59404.1| 1187|Anopheles gambiae SMC2 protein protein. 25 3.8 M93689-1|AAA29368.1| 442|Anopheles gambiae protein ( Anopheles ... 23 8.7 >M93690-1|AAA29364.1| 613|Anopheles gambiae ORF1 protein. Length = 613 Score = 27.9 bits (59), Expect = 0.40 Identities = 11/56 (19%), Positives = 32/56 (57%) Frame = +3 Query: 222 GPQSFDELESEDLYTKYKKLQRMLEFLEVQEEYIKDEQRNLKKEYLHAQEEVKRIQ 389 GPQ ++ + + + + ++ Q+ + + Q++ + +QRN ++E+ Q++ + Q Sbjct: 216 GPQQQEQRQQQQQHQQREQQQQQQQQQQQQQQQQQQQQRNQQREWQQQQQQQQHQQ 271 >AJ535204-1|CAD59404.1| 1187|Anopheles gambiae SMC2 protein protein. Length = 1187 Score = 24.6 bits (51), Expect = 3.8 Identities = 14/48 (29%), Positives = 27/48 (56%) Frame = +3 Query: 300 LEVQEEYIKDEQRNLKKEYLHAQEEVKRIQSVPLVIGQFLEAVDQNTG 443 L+ ++ ++D+Q+N+ E+ +++ V IGQ LE Q+TG Sbjct: 423 LKHSQQLLRDKQKNMNSSDAAYLEDKRKLTKVEGQIGQ-LERELQSTG 469 >M93689-1|AAA29368.1| 442|Anopheles gambiae protein ( Anopheles gambiae T1 retroposon. ). Length = 442 Score = 23.4 bits (48), Expect = 8.7 Identities = 9/19 (47%), Positives = 10/19 (52%) Frame = -3 Query: 489 REYGHNNLSQWCCQLCLYF 433 RE G NN W C+ C F Sbjct: 73 RELGRNNQLLWLCKNCNEF 91 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 701,512 Number of Sequences: 2352 Number of extensions: 11191 Number of successful extensions: 30 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 30 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 30 length of database: 563,979 effective HSP length: 64 effective length of database: 413,451 effective search space used: 88065063 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -