BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= FWDP01_FL5_M18 (856 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF236124-1|AAF68382.1| 107|Anopheles gambiae thioredoxin 1 prot... 36 0.002 AY825832-1|AAV70395.1| 168|Anopheles gambiae heat shock protein... 29 0.24 AY825831-1|AAV70394.1| 168|Anopheles gambiae heat shock protein... 29 0.24 AY825830-1|AAV70393.1| 169|Anopheles gambiae heat shock protein... 29 0.24 AY825829-1|AAV70392.1| 169|Anopheles gambiae heat shock protein... 29 0.24 AY825828-1|AAV70391.1| 172|Anopheles gambiae heat shock protein... 29 0.24 AY825827-1|AAV70390.1| 172|Anopheles gambiae heat shock protein... 29 0.24 AY825826-1|AAV70389.1| 169|Anopheles gambiae heat shock protein... 29 0.24 AY825825-1|AAV70388.1| 169|Anopheles gambiae heat shock protein... 29 0.24 AY825824-1|AAV70387.1| 161|Anopheles gambiae heat shock protein... 29 0.24 AY825823-1|AAV70386.1| 161|Anopheles gambiae heat shock protein... 29 0.24 AY825822-1|AAV70385.1| 159|Anopheles gambiae heat shock protein... 29 0.24 AY825821-1|AAV70384.1| 159|Anopheles gambiae heat shock protein... 29 0.24 AY825820-1|AAV70383.1| 168|Anopheles gambiae heat shock protein... 29 0.24 AY825819-1|AAV70382.1| 168|Anopheles gambiae heat shock protein... 29 0.24 AY825818-1|AAV70381.1| 168|Anopheles gambiae heat shock protein... 29 0.24 AY825817-1|AAV70380.1| 168|Anopheles gambiae heat shock protein... 29 0.24 AY825816-1|AAV70379.1| 162|Anopheles gambiae heat shock protein... 29 0.24 AY825815-1|AAV70378.1| 162|Anopheles gambiae heat shock protein... 29 0.24 AY825814-1|AAV70377.1| 169|Anopheles gambiae heat shock protein... 29 0.24 AY825813-1|AAV70376.1| 169|Anopheles gambiae heat shock protein... 29 0.24 AY825812-1|AAV70375.1| 168|Anopheles gambiae heat shock protein... 29 0.24 AY825811-1|AAV70374.1| 168|Anopheles gambiae heat shock protein... 29 0.24 AY825810-1|AAV70373.1| 169|Anopheles gambiae heat shock protein... 29 0.24 AY825809-1|AAV70372.1| 169|Anopheles gambiae heat shock protein... 29 0.24 AY825808-1|AAV70371.1| 171|Anopheles gambiae heat shock protein... 29 0.24 AY825807-1|AAV70370.1| 171|Anopheles gambiae heat shock protein... 29 0.24 AY825806-1|AAV70369.1| 168|Anopheles gambiae heat shock protein... 29 0.24 AY825805-1|AAV70368.1| 168|Anopheles gambiae heat shock protein... 29 0.24 AY825804-1|AAV70367.1| 168|Anopheles gambiae heat shock protein... 29 0.24 AY825803-1|AAV70366.1| 168|Anopheles gambiae heat shock protein... 29 0.24 AY825802-1|AAV70365.1| 168|Anopheles gambiae heat shock protein... 29 0.24 AY825801-1|AAV70364.1| 168|Anopheles gambiae heat shock protein... 29 0.24 AY825800-1|AAV70363.1| 171|Anopheles gambiae heat shock protein... 29 0.24 AY825799-1|AAV70362.1| 171|Anopheles gambiae heat shock protein... 29 0.24 AY825798-1|AAV70361.1| 168|Anopheles gambiae heat shock protein... 29 0.24 AY825797-1|AAV70360.1| 168|Anopheles gambiae heat shock protein... 29 0.24 AY825796-1|AAV70359.1| 174|Anopheles gambiae heat shock protein... 29 0.24 AY825795-1|AAV70358.1| 174|Anopheles gambiae heat shock protein... 29 0.24 AY825794-1|AAV70357.1| 169|Anopheles gambiae heat shock protein... 29 0.24 AY825793-1|AAV70356.1| 169|Anopheles gambiae heat shock protein... 29 0.24 AY825792-1|AAV70355.1| 153|Anopheles gambiae heat shock protein... 29 0.24 AY825791-1|AAV70354.1| 153|Anopheles gambiae heat shock protein... 29 0.24 AY825790-1|AAV70353.1| 168|Anopheles gambiae heat shock protein... 29 0.24 AY825789-1|AAV70352.1| 168|Anopheles gambiae heat shock protein... 29 0.24 AY825788-1|AAV70351.1| 168|Anopheles gambiae heat shock protein... 29 0.24 AY825787-1|AAV70350.1| 168|Anopheles gambiae heat shock protein... 29 0.24 AY825786-1|AAV70349.1| 168|Anopheles gambiae heat shock protein... 29 0.24 AY825785-1|AAV70348.1| 168|Anopheles gambiae heat shock protein... 29 0.24 AY825784-1|AAV70347.1| 168|Anopheles gambiae heat shock protein... 29 0.24 AY825783-1|AAV70346.1| 168|Anopheles gambiae heat shock protein... 29 0.24 AY825782-1|AAV70345.1| 168|Anopheles gambiae heat shock protein... 29 0.24 AY825781-1|AAV70344.1| 168|Anopheles gambiae heat shock protein... 29 0.24 Z22925-1|CAA80505.1| 211|Anopheles gambiae ANG12 precursor prot... 26 1.7 CR954257-12|CAJ14163.1| 1645|Anopheles gambiae putative cytoskel... 25 2.9 AJ237664-1|CAB40379.2| 81|Anopheles gambiae putative infection... 25 2.9 AF117750-1|AAD38336.1| 380|Anopheles gambiae serine protease 18... 25 2.9 AY146734-1|AAO12094.1| 176|Anopheles gambiae odorant-binding pr... 24 6.8 >AF236124-1|AAF68382.1| 107|Anopheles gambiae thioredoxin 1 protein. Length = 107 Score = 35.9 bits (79), Expect = 0.002 Identities = 22/87 (25%), Positives = 40/87 (45%), Gaps = 2/87 (2%) Frame = +1 Query: 211 DFSAVLSQHDTALVM--FYAPWCGHCKRLKPEYAVAAGLLKTDVPPVALAKVDCTEGGKS 384 DF+ L LV+ F+A WCG CK + P+ + + KVD E + Sbjct: 10 DFNNKLEAAGDQLVVVDFFATWCGPCKVIAPK---LEEFQNKYADKIVVVKVDVDE-CEE 65 Query: 385 TCEQFSVSGYPTLKIFRKGELSSEYNG 465 Q++++ PT ++ E+ +++G Sbjct: 66 LAAQYNIASMPTFLFIKRKEVVGQFSG 92 >AY825832-1|AAV70395.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 28.7 bits (61), Expect = 0.24 Identities = 9/20 (45%), Positives = 13/20 (65%) Frame = +1 Query: 229 SQHDTALVMFYAPWCGHCKR 288 S+H ++MFYA WC C + Sbjct: 88 SRHTPQIIMFYADWCFACMK 107 >AY825831-1|AAV70394.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 28.7 bits (61), Expect = 0.24 Identities = 9/20 (45%), Positives = 13/20 (65%) Frame = +1 Query: 229 SQHDTALVMFYAPWCGHCKR 288 S+H ++MFYA WC C + Sbjct: 88 SRHTPQIIMFYADWCFACMK 107 >AY825830-1|AAV70393.1| 169|Anopheles gambiae heat shock protein DnaJ protein. Length = 169 Score = 28.7 bits (61), Expect = 0.24 Identities = 9/20 (45%), Positives = 13/20 (65%) Frame = +1 Query: 229 SQHDTALVMFYAPWCGHCKR 288 S+H ++MFYA WC C + Sbjct: 89 SRHTPQIIMFYADWCFACMK 108 >AY825829-1|AAV70392.1| 169|Anopheles gambiae heat shock protein DnaJ protein. Length = 169 Score = 28.7 bits (61), Expect = 0.24 Identities = 9/20 (45%), Positives = 13/20 (65%) Frame = +1 Query: 229 SQHDTALVMFYAPWCGHCKR 288 S+H ++MFYA WC C + Sbjct: 89 SRHTPQIIMFYADWCFACMK 108 >AY825828-1|AAV70391.1| 172|Anopheles gambiae heat shock protein DnaJ protein. Length = 172 Score = 28.7 bits (61), Expect = 0.24 Identities = 9/20 (45%), Positives = 13/20 (65%) Frame = +1 Query: 229 SQHDTALVMFYAPWCGHCKR 288 S+H ++MFYA WC C + Sbjct: 89 SRHTPQIIMFYADWCFACMK 108 >AY825827-1|AAV70390.1| 172|Anopheles gambiae heat shock protein DnaJ protein. Length = 172 Score = 28.7 bits (61), Expect = 0.24 Identities = 9/20 (45%), Positives = 13/20 (65%) Frame = +1 Query: 229 SQHDTALVMFYAPWCGHCKR 288 S+H ++MFYA WC C + Sbjct: 89 SRHTPQIIMFYADWCFACMK 108 >AY825826-1|AAV70389.1| 169|Anopheles gambiae heat shock protein DnaJ protein. Length = 169 Score = 28.7 bits (61), Expect = 0.24 Identities = 9/20 (45%), Positives = 13/20 (65%) Frame = +1 Query: 229 SQHDTALVMFYAPWCGHCKR 288 S+H ++MFYA WC C + Sbjct: 89 SRHTPQIIMFYADWCFACMK 108 >AY825825-1|AAV70388.1| 169|Anopheles gambiae heat shock protein DnaJ protein. Length = 169 Score = 28.7 bits (61), Expect = 0.24 Identities = 9/20 (45%), Positives = 13/20 (65%) Frame = +1 Query: 229 SQHDTALVMFYAPWCGHCKR 288 S+H ++MFYA WC C + Sbjct: 89 SRHTPQIIMFYADWCFACMK 108 >AY825824-1|AAV70387.1| 161|Anopheles gambiae heat shock protein DnaJ protein. Length = 161 Score = 28.7 bits (61), Expect = 0.24 Identities = 9/20 (45%), Positives = 13/20 (65%) Frame = +1 Query: 229 SQHDTALVMFYAPWCGHCKR 288 S+H ++MFYA WC C + Sbjct: 74 SRHTPQIIMFYADWCFACMK 93 >AY825823-1|AAV70386.1| 161|Anopheles gambiae heat shock protein DnaJ protein. Length = 161 Score = 28.7 bits (61), Expect = 0.24 Identities = 9/20 (45%), Positives = 13/20 (65%) Frame = +1 Query: 229 SQHDTALVMFYAPWCGHCKR 288 S+H ++MFYA WC C + Sbjct: 74 SRHTPQIIMFYADWCFACMK 93 >AY825822-1|AAV70385.1| 159|Anopheles gambiae heat shock protein DnaJ protein. Length = 159 Score = 28.7 bits (61), Expect = 0.24 Identities = 9/20 (45%), Positives = 13/20 (65%) Frame = +1 Query: 229 SQHDTALVMFYAPWCGHCKR 288 S+H ++MFYA WC C + Sbjct: 76 SRHTPQIIMFYADWCFACMK 95 >AY825821-1|AAV70384.1| 159|Anopheles gambiae heat shock protein DnaJ protein. Length = 159 Score = 28.7 bits (61), Expect = 0.24 Identities = 9/20 (45%), Positives = 13/20 (65%) Frame = +1 Query: 229 SQHDTALVMFYAPWCGHCKR 288 S+H ++MFYA WC C + Sbjct: 76 SRHTPQIIMFYADWCFACMK 95 >AY825820-1|AAV70383.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 28.7 bits (61), Expect = 0.24 Identities = 9/20 (45%), Positives = 13/20 (65%) Frame = +1 Query: 229 SQHDTALVMFYAPWCGHCKR 288 S+H ++MFYA WC C + Sbjct: 88 SRHTPQIIMFYADWCFACMK 107 >AY825819-1|AAV70382.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 28.7 bits (61), Expect = 0.24 Identities = 9/20 (45%), Positives = 13/20 (65%) Frame = +1 Query: 229 SQHDTALVMFYAPWCGHCKR 288 S+H ++MFYA WC C + Sbjct: 88 SRHTPQIIMFYADWCFACMK 107 >AY825818-1|AAV70381.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 28.7 bits (61), Expect = 0.24 Identities = 9/20 (45%), Positives = 13/20 (65%) Frame = +1 Query: 229 SQHDTALVMFYAPWCGHCKR 288 S+H ++MFYA WC C + Sbjct: 88 SRHTPQIIMFYADWCFACMK 107 >AY825817-1|AAV70380.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 28.7 bits (61), Expect = 0.24 Identities = 9/20 (45%), Positives = 13/20 (65%) Frame = +1 Query: 229 SQHDTALVMFYAPWCGHCKR 288 S+H ++MFYA WC C + Sbjct: 88 SRHTPQIIMFYADWCFACMK 107 >AY825816-1|AAV70379.1| 162|Anopheles gambiae heat shock protein DnaJ protein. Length = 162 Score = 28.7 bits (61), Expect = 0.24 Identities = 9/20 (45%), Positives = 13/20 (65%) Frame = +1 Query: 229 SQHDTALVMFYAPWCGHCKR 288 S+H ++MFYA WC C + Sbjct: 79 SRHTPQIIMFYADWCFACMK 98 >AY825815-1|AAV70378.1| 162|Anopheles gambiae heat shock protein DnaJ protein. Length = 162 Score = 28.7 bits (61), Expect = 0.24 Identities = 9/20 (45%), Positives = 13/20 (65%) Frame = +1 Query: 229 SQHDTALVMFYAPWCGHCKR 288 S+H ++MFYA WC C + Sbjct: 79 SRHTPQIIMFYADWCFACMK 98 >AY825814-1|AAV70377.1| 169|Anopheles gambiae heat shock protein DnaJ protein. Length = 169 Score = 28.7 bits (61), Expect = 0.24 Identities = 9/20 (45%), Positives = 13/20 (65%) Frame = +1 Query: 229 SQHDTALVMFYAPWCGHCKR 288 S+H ++MFYA WC C + Sbjct: 89 SRHTPQIIMFYADWCFACMK 108 >AY825813-1|AAV70376.1| 169|Anopheles gambiae heat shock protein DnaJ protein. Length = 169 Score = 28.7 bits (61), Expect = 0.24 Identities = 9/20 (45%), Positives = 13/20 (65%) Frame = +1 Query: 229 SQHDTALVMFYAPWCGHCKR 288 S+H ++MFYA WC C + Sbjct: 89 SRHTPQIIMFYADWCFACMK 108 >AY825812-1|AAV70375.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 28.7 bits (61), Expect = 0.24 Identities = 9/20 (45%), Positives = 13/20 (65%) Frame = +1 Query: 229 SQHDTALVMFYAPWCGHCKR 288 S+H ++MFYA WC C + Sbjct: 88 SRHTPQIIMFYADWCFACMK 107 >AY825811-1|AAV70374.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 28.7 bits (61), Expect = 0.24 Identities = 9/20 (45%), Positives = 13/20 (65%) Frame = +1 Query: 229 SQHDTALVMFYAPWCGHCKR 288 S+H ++MFYA WC C + Sbjct: 88 SRHTPQIIMFYADWCFACMK 107 >AY825810-1|AAV70373.1| 169|Anopheles gambiae heat shock protein DnaJ protein. Length = 169 Score = 28.7 bits (61), Expect = 0.24 Identities = 9/20 (45%), Positives = 13/20 (65%) Frame = +1 Query: 229 SQHDTALVMFYAPWCGHCKR 288 S+H ++MFYA WC C + Sbjct: 89 SRHTPQIIMFYADWCFACMK 108 >AY825809-1|AAV70372.1| 169|Anopheles gambiae heat shock protein DnaJ protein. Length = 169 Score = 28.7 bits (61), Expect = 0.24 Identities = 9/20 (45%), Positives = 13/20 (65%) Frame = +1 Query: 229 SQHDTALVMFYAPWCGHCKR 288 S+H ++MFYA WC C + Sbjct: 89 SRHTPQIIMFYADWCFACMK 108 >AY825808-1|AAV70371.1| 171|Anopheles gambiae heat shock protein DnaJ protein. Length = 171 Score = 28.7 bits (61), Expect = 0.24 Identities = 9/20 (45%), Positives = 13/20 (65%) Frame = +1 Query: 229 SQHDTALVMFYAPWCGHCKR 288 S+H ++MFYA WC C + Sbjct: 88 SRHTPQIIMFYADWCFACMK 107 >AY825807-1|AAV70370.1| 171|Anopheles gambiae heat shock protein DnaJ protein. Length = 171 Score = 28.7 bits (61), Expect = 0.24 Identities = 9/20 (45%), Positives = 13/20 (65%) Frame = +1 Query: 229 SQHDTALVMFYAPWCGHCKR 288 S+H ++MFYA WC C + Sbjct: 88 SRHTPQIIMFYADWCFACMK 107 >AY825806-1|AAV70369.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 28.7 bits (61), Expect = 0.24 Identities = 9/20 (45%), Positives = 13/20 (65%) Frame = +1 Query: 229 SQHDTALVMFYAPWCGHCKR 288 S+H ++MFYA WC C + Sbjct: 88 SRHTPQIIMFYADWCFACMK 107 >AY825805-1|AAV70368.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 28.7 bits (61), Expect = 0.24 Identities = 9/20 (45%), Positives = 13/20 (65%) Frame = +1 Query: 229 SQHDTALVMFYAPWCGHCKR 288 S+H ++MFYA WC C + Sbjct: 88 SRHTPQIIMFYADWCFACMK 107 >AY825804-1|AAV70367.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 28.7 bits (61), Expect = 0.24 Identities = 9/20 (45%), Positives = 13/20 (65%) Frame = +1 Query: 229 SQHDTALVMFYAPWCGHCKR 288 S+H ++MFYA WC C + Sbjct: 88 SRHTPQIIMFYADWCFACMK 107 >AY825803-1|AAV70366.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 28.7 bits (61), Expect = 0.24 Identities = 9/20 (45%), Positives = 13/20 (65%) Frame = +1 Query: 229 SQHDTALVMFYAPWCGHCKR 288 S+H ++MFYA WC C + Sbjct: 88 SRHTPQIIMFYADWCFACMK 107 >AY825802-1|AAV70365.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 28.7 bits (61), Expect = 0.24 Identities = 9/20 (45%), Positives = 13/20 (65%) Frame = +1 Query: 229 SQHDTALVMFYAPWCGHCKR 288 S+H ++MFYA WC C + Sbjct: 88 SRHTPQIIMFYADWCFACMK 107 >AY825801-1|AAV70364.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 28.7 bits (61), Expect = 0.24 Identities = 9/20 (45%), Positives = 13/20 (65%) Frame = +1 Query: 229 SQHDTALVMFYAPWCGHCKR 288 S+H ++MFYA WC C + Sbjct: 88 SRHTPQIIMFYADWCFACMK 107 >AY825800-1|AAV70363.1| 171|Anopheles gambiae heat shock protein DnaJ protein. Length = 171 Score = 28.7 bits (61), Expect = 0.24 Identities = 9/20 (45%), Positives = 13/20 (65%) Frame = +1 Query: 229 SQHDTALVMFYAPWCGHCKR 288 S+H ++MFYA WC C + Sbjct: 89 SRHTPQIIMFYADWCFACMK 108 >AY825799-1|AAV70362.1| 171|Anopheles gambiae heat shock protein DnaJ protein. Length = 171 Score = 28.7 bits (61), Expect = 0.24 Identities = 9/20 (45%), Positives = 13/20 (65%) Frame = +1 Query: 229 SQHDTALVMFYAPWCGHCKR 288 S+H ++MFYA WC C + Sbjct: 89 SRHTPQIIMFYADWCFACMK 108 >AY825798-1|AAV70361.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 28.7 bits (61), Expect = 0.24 Identities = 9/20 (45%), Positives = 13/20 (65%) Frame = +1 Query: 229 SQHDTALVMFYAPWCGHCKR 288 S+H ++MFYA WC C + Sbjct: 88 SRHTPQIIMFYADWCFACMK 107 >AY825797-1|AAV70360.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 28.7 bits (61), Expect = 0.24 Identities = 9/20 (45%), Positives = 13/20 (65%) Frame = +1 Query: 229 SQHDTALVMFYAPWCGHCKR 288 S+H ++MFYA WC C + Sbjct: 88 SRHTPQIIMFYADWCFACMK 107 >AY825796-1|AAV70359.1| 174|Anopheles gambiae heat shock protein DnaJ protein. Length = 174 Score = 28.7 bits (61), Expect = 0.24 Identities = 9/20 (45%), Positives = 13/20 (65%) Frame = +1 Query: 229 SQHDTALVMFYAPWCGHCKR 288 S+H ++MFYA WC C + Sbjct: 91 SRHTPQIIMFYADWCFACMK 110 >AY825795-1|AAV70358.1| 174|Anopheles gambiae heat shock protein DnaJ protein. Length = 174 Score = 28.7 bits (61), Expect = 0.24 Identities = 9/20 (45%), Positives = 13/20 (65%) Frame = +1 Query: 229 SQHDTALVMFYAPWCGHCKR 288 S+H ++MFYA WC C + Sbjct: 91 SRHTPQIIMFYADWCFACMK 110 >AY825794-1|AAV70357.1| 169|Anopheles gambiae heat shock protein DnaJ protein. Length = 169 Score = 28.7 bits (61), Expect = 0.24 Identities = 9/20 (45%), Positives = 13/20 (65%) Frame = +1 Query: 229 SQHDTALVMFYAPWCGHCKR 288 S+H ++MFYA WC C + Sbjct: 88 SRHTPQIIMFYADWCFACMK 107 >AY825793-1|AAV70356.1| 169|Anopheles gambiae heat shock protein DnaJ protein. Length = 169 Score = 28.7 bits (61), Expect = 0.24 Identities = 9/20 (45%), Positives = 13/20 (65%) Frame = +1 Query: 229 SQHDTALVMFYAPWCGHCKR 288 S+H ++MFYA WC C + Sbjct: 88 SRHTPQIIMFYADWCFACMK 107 >AY825792-1|AAV70355.1| 153|Anopheles gambiae heat shock protein DnaJ protein. Length = 153 Score = 28.7 bits (61), Expect = 0.24 Identities = 9/20 (45%), Positives = 13/20 (65%) Frame = +1 Query: 229 SQHDTALVMFYAPWCGHCKR 288 S+H ++MFYA WC C + Sbjct: 73 SRHTPQIIMFYADWCFACMK 92 >AY825791-1|AAV70354.1| 153|Anopheles gambiae heat shock protein DnaJ protein. Length = 153 Score = 28.7 bits (61), Expect = 0.24 Identities = 9/20 (45%), Positives = 13/20 (65%) Frame = +1 Query: 229 SQHDTALVMFYAPWCGHCKR 288 S+H ++MFYA WC C + Sbjct: 73 SRHTPQIIMFYADWCFACMK 92 >AY825790-1|AAV70353.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 28.7 bits (61), Expect = 0.24 Identities = 9/20 (45%), Positives = 13/20 (65%) Frame = +1 Query: 229 SQHDTALVMFYAPWCGHCKR 288 S+H ++MFYA WC C + Sbjct: 88 SRHTPQIIMFYADWCFACMK 107 >AY825789-1|AAV70352.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 28.7 bits (61), Expect = 0.24 Identities = 9/20 (45%), Positives = 13/20 (65%) Frame = +1 Query: 229 SQHDTALVMFYAPWCGHCKR 288 S+H ++MFYA WC C + Sbjct: 88 SRHTPQIIMFYADWCFACMK 107 >AY825788-1|AAV70351.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 28.7 bits (61), Expect = 0.24 Identities = 9/20 (45%), Positives = 13/20 (65%) Frame = +1 Query: 229 SQHDTALVMFYAPWCGHCKR 288 S+H ++MFYA WC C + Sbjct: 88 SRHTPQIIMFYADWCFACMK 107 >AY825787-1|AAV70350.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 28.7 bits (61), Expect = 0.24 Identities = 9/20 (45%), Positives = 13/20 (65%) Frame = +1 Query: 229 SQHDTALVMFYAPWCGHCKR 288 S+H ++MFYA WC C + Sbjct: 88 SRHTPQIIMFYADWCFACMK 107 >AY825786-1|AAV70349.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 28.7 bits (61), Expect = 0.24 Identities = 9/20 (45%), Positives = 13/20 (65%) Frame = +1 Query: 229 SQHDTALVMFYAPWCGHCKR 288 S+H ++MFYA WC C + Sbjct: 88 SRHTPQIIMFYADWCFACMK 107 >AY825785-1|AAV70348.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 28.7 bits (61), Expect = 0.24 Identities = 9/20 (45%), Positives = 13/20 (65%) Frame = +1 Query: 229 SQHDTALVMFYAPWCGHCKR 288 S+H ++MFYA WC C + Sbjct: 88 SRHTPQIIMFYADWCFACMK 107 >AY825784-1|AAV70347.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 28.7 bits (61), Expect = 0.24 Identities = 9/20 (45%), Positives = 13/20 (65%) Frame = +1 Query: 229 SQHDTALVMFYAPWCGHCKR 288 S+H ++MFYA WC C + Sbjct: 88 SRHTPQIIMFYADWCFACMK 107 >AY825783-1|AAV70346.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 28.7 bits (61), Expect = 0.24 Identities = 9/20 (45%), Positives = 13/20 (65%) Frame = +1 Query: 229 SQHDTALVMFYAPWCGHCKR 288 S+H ++MFYA WC C + Sbjct: 88 SRHTPQIIMFYADWCFACMK 107 >AY825782-1|AAV70345.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 28.7 bits (61), Expect = 0.24 Identities = 9/20 (45%), Positives = 13/20 (65%) Frame = +1 Query: 229 SQHDTALVMFYAPWCGHCKR 288 S+H ++MFYA WC C + Sbjct: 88 SRHTPQIIMFYADWCFACMK 107 >AY825781-1|AAV70344.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 28.7 bits (61), Expect = 0.24 Identities = 9/20 (45%), Positives = 13/20 (65%) Frame = +1 Query: 229 SQHDTALVMFYAPWCGHCKR 288 S+H ++MFYA WC C + Sbjct: 88 SRHTPQIIMFYADWCFACMK 107 >Z22925-1|CAA80505.1| 211|Anopheles gambiae ANG12 precursor protein. Length = 211 Score = 25.8 bits (54), Expect = 1.7 Identities = 19/44 (43%), Positives = 22/44 (50%) Frame = -2 Query: 807 KALRTXFXVSVEATR*VFKLVLESLGTIQDHIVFVSGFFKNFIG 676 K LR + S E + KL ESLG DHIV V K+F G Sbjct: 171 KQLRALYESSTEVQNMIHKL--ESLGVDVDHIVEV---LKDFFG 209 >CR954257-12|CAJ14163.1| 1645|Anopheles gambiae putative cytoskeletal structural protein protein. Length = 1645 Score = 25.0 bits (52), Expect = 2.9 Identities = 28/102 (27%), Positives = 39/102 (38%), Gaps = 3/102 (2%) Frame = -3 Query: 617 PFRSDSFSKNPTTTTSSLEVKASKSATVRSSLELGPTWARMYL--TMPLDSLGPLYSEES 444 P + ++ K PT E K+S S E P A L P ++L P S Sbjct: 1428 PILTTTYLK-PTLAALQNEAKSSYQQQPDSGTEQAPREATAQLPPVQPPETLTPAGSVAI 1486 Query: 443 SPFLNIFSVGYPDTENCSQVL-LPPSVQSTLASATGGTSVFN 321 + ++ D E S V PP A+ TGG +V N Sbjct: 1487 TVEPSVPPATTTDLEPESGVSEAPPGTDGAAAAPTGGAAVTN 1528 >AJ237664-1|CAB40379.2| 81|Anopheles gambiae putative infection responsive shortpeptide protein. Length = 81 Score = 25.0 bits (52), Expect = 2.9 Identities = 9/20 (45%), Positives = 11/20 (55%) Frame = +1 Query: 244 ALVMFYAPWCGHCKRLKPEY 303 A+V YAP C CK + Y Sbjct: 20 AMVFAYAPTCARCKSIGARY 39 >AF117750-1|AAD38336.1| 380|Anopheles gambiae serine protease 18D protein. Length = 380 Score = 25.0 bits (52), Expect = 2.9 Identities = 14/45 (31%), Positives = 20/45 (44%) Frame = +2 Query: 365 VRKVARVLVNNSLCPDILH*KYSEKESFLPSTMDQGSLMALSSTC 499 +RKVA + NN LC + ++ L + M G L TC Sbjct: 281 LRKVALNIYNNELCAERYRYDRHLRQGILSTQMCVGDLAGGKDTC 325 >AY146734-1|AAO12094.1| 176|Anopheles gambiae odorant-binding protein AgamOBP24 protein. Length = 176 Score = 23.8 bits (49), Expect = 6.8 Identities = 26/116 (22%), Positives = 49/116 (42%), Gaps = 6/116 (5%) Frame = +1 Query: 367 TEGGKSTCEQFSVSGYPTLKIF----RKGELSSEYNGPRESNGIVKYMRAQVGPSSKELL 534 TEGG++ + F + Y +L +F + L +E+ N + P + + Sbjct: 21 TEGGRNA-DNFKL--YSSLFVFPSPLQGARLEAEHVRRIHQNARECVKETGILPKNAFRV 77 Query: 535 TVADFEAFTSKDEVVVVGFFEKESDLKGEFLKTADKLREEVT--FAHSSANEVLEK 696 DF T K + V F +K + + + D +RE++T NE+++K Sbjct: 78 LSGDFSVDTMKAKCFVKCFLDKAGFIDDDGVIQQDVIREKLTVGIEAGKVNELIKK 133 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 853,403 Number of Sequences: 2352 Number of extensions: 18306 Number of successful extensions: 85 Number of sequences better than 10.0: 58 Number of HSP's better than 10.0 without gapping: 85 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 85 length of database: 563,979 effective HSP length: 64 effective length of database: 413,451 effective search space used: 90959220 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -