BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= FWDP01_FL5_M14 (824 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value CR954256-7|CAJ14148.1| 1087|Anopheles gambiae predicted protein ... 27 0.70 AJ535206-1|CAD59406.1| 1376|Anopheles gambiae SMC4 protein protein. 25 3.7 >CR954256-7|CAJ14148.1| 1087|Anopheles gambiae predicted protein protein. Length = 1087 Score = 27.1 bits (57), Expect = 0.70 Identities = 17/39 (43%), Positives = 23/39 (58%), Gaps = 1/39 (2%) Frame = +1 Query: 598 LSEIRKGIDNLSENVRNDYXKRXLLQ-EVTIKSFLLSKG 711 L+ R +D+LS N+ N Y KR L + +KSFLL G Sbjct: 330 LTTNRSAVDSLSSNLWN-YTKRHLARMHAFVKSFLLLGG 367 >AJ535206-1|CAD59406.1| 1376|Anopheles gambiae SMC4 protein protein. Length = 1376 Score = 24.6 bits (51), Expect = 3.7 Identities = 16/49 (32%), Positives = 27/49 (55%) Frame = +1 Query: 226 LENSDKADTLKLCEEFNEEHQKIVGAVKSLEALEMVISEAVKITKWELT 372 L+ +++ D L EE E+H + A + ++ LE +EAV+ K E T Sbjct: 256 LKINERVDALN--EERTEKHNRCKLAEREMKDLEKPKTEAVEYLKQENT 302 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 718,273 Number of Sequences: 2352 Number of extensions: 13329 Number of successful extensions: 36 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 35 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 36 length of database: 563,979 effective HSP length: 63 effective length of database: 415,803 effective search space used: 87734433 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -