BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= FWDP01_FL5_M11 (848 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPCC31H12.03c |||transcriptional regulator|Schizosaccharomyces p... 33 0.039 SPAC15A10.16 |bud6|aip3, fat1, SPAC15E1.01|actin interacting pro... 26 5.9 SPAC6F12.02 |rst2||transcription factor Rst2|Schizosaccharomyces... 26 7.8 >SPCC31H12.03c |||transcriptional regulator|Schizosaccharomyces pombe|chr 3|||Manual Length = 245 Score = 33.5 bits (73), Expect = 0.039 Identities = 18/55 (32%), Positives = 29/55 (52%), Gaps = 1/55 (1%) Frame = -2 Query: 613 TRNPSPRQSSRASLEYLLLPPRSAPTEAPSGLTPRPFCALR-RARPTRYGLMIPN 452 ++NP R +SR+ PP+SAP++ S + P A + R R R+G+ N Sbjct: 191 SKNPQNRSNSRSKQRNKNAPPKSAPSKRKSNILDDPIEAEKARKRAERFGVAAKN 245 >SPAC15A10.16 |bud6|aip3, fat1, SPAC15E1.01|actin interacting protein 3 homolog Bud6|Schizosaccharomyces pombe|chr 1|||Manual Length = 1385 Score = 26.2 bits (55), Expect = 5.9 Identities = 15/49 (30%), Positives = 22/49 (44%) Frame = +1 Query: 691 IFKNNEK*RPLSERESGSYSGTRQRNRFNNRPSSLKRVSTGYPKWPENP 837 + N++ + + E S T + N PSS VS YPK P +P Sbjct: 650 VISNDDSTQVEEDSEDKSTPNTGASAKLINDPSSTITVSDVYPKKPASP 698 >SPAC6F12.02 |rst2||transcription factor Rst2|Schizosaccharomyces pombe|chr 1|||Manual Length = 567 Score = 25.8 bits (54), Expect = 7.8 Identities = 18/53 (33%), Positives = 25/53 (47%) Frame = -2 Query: 643 DRLTREQLLFTRNPSPRQSSRASLEYLLLPPRSAPTEAPSGLTPRPFCALRRA 485 D L R Q RNP PR+ R S L P S + + + L +P +L +A Sbjct: 118 DLLLRHQQKIHRNPQPRR-RRRSTTALPNPSLSNVSVSTTNLASKPVISLPQA 169 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 3,656,080 Number of Sequences: 5004 Number of extensions: 77851 Number of successful extensions: 200 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 196 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 200 length of database: 2,362,478 effective HSP length: 72 effective length of database: 2,002,190 effective search space used: 420459900 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -