BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= FWDP01_FL5_M11 (848 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_30216| Best HMM Match : TIL (HMM E-Value=3.1) 72 5e-13 SB_14965| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 5e-13 SB_6863| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 5e-13 SB_5602| Best HMM Match : No HMM Matches (HMM E-Value=.) 61 1e-09 SB_49647| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 3e-09 SB_27787| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 2e-08 SB_52007| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 1e-07 SB_9493| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 1e-07 SB_23689| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 3e-07 SB_53289| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 4e-07 SB_49224| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 4e-07 SB_27353| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 4e-07 SB_58055| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 1e-06 SB_54389| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 1e-06 SB_51835| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 1e-06 SB_48809| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 1e-06 SB_41857| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 1e-06 SB_40886| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 1e-06 SB_40435| Best HMM Match : DUF1677 (HMM E-Value=4.2) 51 1e-06 SB_9214| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 1e-06 SB_5959| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 1e-06 SB_3984| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 1e-06 SB_47626| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 1e-06 SB_27272| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 1e-06 SB_55300| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 4e-06 SB_53216| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 4e-06 SB_24856| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 4e-06 SB_16637| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 4e-06 SB_19053| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 4e-06 SB_35257| Best HMM Match : Sec8_exocyst (HMM E-Value=0.59) 48 1e-05 SB_40315| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 9e-05 SB_32500| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 9e-05 SB_24543| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 9e-05 SB_20448| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 9e-05 SB_5288| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 9e-05 SB_4968| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 9e-05 SB_3995| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 9e-05 SB_1350| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 9e-05 SB_59236| Best HMM Match : Attractin (HMM E-Value=8.2) 45 9e-05 SB_53668| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 9e-05 SB_53194| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 9e-05 SB_47973| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 9e-05 SB_40285| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 9e-05 SB_16426| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 9e-05 SB_15603| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 9e-05 SB_19187| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_161| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 2e-04 SB_11440| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 8e-04 SB_18857| Best HMM Match : Gln-synt_N (HMM E-Value=1.5) 42 8e-04 SB_29359| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.002 SB_24059| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.003 SB_40592| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.003 SB_9995| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.008 SB_24609| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.055 SB_18772| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.17 SB_20402| Best HMM Match : Transformer (HMM E-Value=2.1) 32 0.51 SB_6844| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.6 SB_50854| Best HMM Match : ig (HMM E-Value=6.1e-27) 30 2.7 SB_39247| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.6 SB_37973| Best HMM Match : ABC_tran (HMM E-Value=0) 29 4.8 >SB_30216| Best HMM Match : TIL (HMM E-Value=3.1) Length = 212 Score = 72.1 bits (169), Expect = 5e-13 Identities = 32/40 (80%), Positives = 33/40 (82%) Frame = +2 Query: 305 TAGRWPWKSESAKECATTHLPKQPALKMDGAEAFCLYTTV 424 TAGRWPWK ESAKEC TTHLPKQ ALKMDGA+A LY V Sbjct: 1 TAGRWPWKLESAKECVTTHLPKQLALKMDGAQASHLYRAV 40 Score = 39.9 bits (89), Expect = 0.003 Identities = 22/43 (51%), Positives = 26/43 (60%) Frame = +3 Query: 480 GRARRRAQKGLGVSPLGASVGADLGGSSKYSSEALED*RGEGF 608 GR R A G + +S ADLGGSSKYS+E+ ED GE F Sbjct: 51 GRGGRDAASGASLGETASS--ADLGGSSKYSNESFEDRSGERF 91 >SB_14965| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 295 Score = 72.1 bits (169), Expect = 5e-13 Identities = 32/40 (80%), Positives = 33/40 (82%) Frame = +2 Query: 305 TAGRWPWKSESAKECATTHLPKQPALKMDGAEAFCLYTTV 424 TAGRWPWK ESAKEC TTHLPKQ ALKMDGA+A LY V Sbjct: 1 TAGRWPWKLESAKECVTTHLPKQLALKMDGAQASHLYRAV 40 Score = 39.9 bits (89), Expect = 0.003 Identities = 22/43 (51%), Positives = 26/43 (60%) Frame = +3 Query: 480 GRARRRAQKGLGVSPLGASVGADLGGSSKYSSEALED*RGEGF 608 GR R A G + +S ADLGGSSKYS+E+ ED GE F Sbjct: 51 GRGGRDAASGASLGETASS--ADLGGSSKYSNESFEDRSGERF 91 >SB_6863| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 182 Score = 72.1 bits (169), Expect = 5e-13 Identities = 32/40 (80%), Positives = 33/40 (82%) Frame = +2 Query: 305 TAGRWPWKSESAKECATTHLPKQPALKMDGAEAFCLYTTV 424 TAGRWPWK ESAKEC TTHLPKQ ALKMDGA+A LY V Sbjct: 80 TAGRWPWKLESAKECVTTHLPKQLALKMDGAQASHLYRAV 119 Score = 39.9 bits (89), Expect = 0.003 Identities = 22/43 (51%), Positives = 26/43 (60%) Frame = +3 Query: 480 GRARRRAQKGLGVSPLGASVGADLGGSSKYSSEALED*RGEGF 608 GR R A G + +S ADLGGSSKYS+E+ ED GE F Sbjct: 130 GRGGRDAASGASLGETASS--ADLGGSSKYSNESFEDRSGERF 170 >SB_5602| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 130 Score = 61.3 bits (142), Expect = 1e-09 Identities = 50/121 (41%), Positives = 61/121 (50%), Gaps = 1/121 (0%) Frame = +3 Query: 249 VKAPKKRSWDTMKGVGRS*QQDGGHGSRNPLRSVQRLTCRSNQP*KWMALKRFAYTLPLP 428 ++ +RS D KGVG S QQDGGHGS NPL+ C + K +ALK Sbjct: 9 LRCQSRRSSDPTKGVGCSRQQDGGHGSWNPLKE-----CVTTPLPKQLALKMDG----AQ 59 Query: 429 ARVMLNF*FGIIKP*RV-GRARRRAQKGLGVSPLGASVGADLGGSSKYSSEALED*RGEG 605 A + K RV GR R A G + +S ADLGGSSKYS+E+ ED GE Sbjct: 60 ASHLYRAVGADAKLRRVGGRGGRDAASGASLGETASS--ADLGGSSKYSNESFEDRSGER 117 Query: 606 F 608 F Sbjct: 118 F 118 Score = 41.9 bits (94), Expect = 6e-04 Identities = 20/28 (71%), Positives = 21/28 (75%) Frame = +2 Query: 341 KECATTHLPKQPALKMDGAEAFCLYTTV 424 KEC TT LPKQ ALKMDGA+A LY V Sbjct: 40 KECVTTPLPKQLALKMDGAQASHLYRAV 67 >SB_49647| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 126 Score = 59.7 bits (138), Expect = 3e-09 Identities = 49/121 (40%), Positives = 60/121 (49%), Gaps = 1/121 (0%) Frame = +3 Query: 249 VKAPKKRSWDTMKGVGRS*QQDGGHGSRNPLRSVQRLTCRSNQP*KWMALKRFAYTLPLP 428 ++ +RS D KGVG S QQDGGHGS NP + C + K +ALK Sbjct: 9 LRCQSRRSSDPTKGVGCSRQQDGGHGSWNPAKE-----CVTTHLPKQLALKMDG----AQ 59 Query: 429 ARVMLNF*FGIIKP*RV-GRARRRAQKGLGVSPLGASVGADLGGSSKYSSEALED*RGEG 605 A + K RV GR R A G + +S ADLGGSSKYS+E+ ED GE Sbjct: 60 ASHLYRAVGADAKLRRVGGRGGRDAASGASLGETASS--ADLGGSSKYSNESFEDRSGER 117 Query: 606 F 608 F Sbjct: 118 F 118 Score = 47.6 bits (108), Expect = 1e-05 Identities = 22/29 (75%), Positives = 23/29 (79%) Frame = +2 Query: 338 AKECATTHLPKQPALKMDGAEAFCLYTTV 424 AKEC TTHLPKQ ALKMDGA+A LY V Sbjct: 39 AKECVTTHLPKQLALKMDGAQASHLYRAV 67 >SB_27787| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 99 Score = 56.8 bits (131), Expect = 2e-08 Identities = 28/40 (70%), Positives = 30/40 (75%) Frame = +2 Query: 305 TAGRWPWKSESAKECATTHLPKQPALKMDGAEAFCLYTTV 424 TAGR + ESAKEC TTHLPKQ ALKMDGA+A LY V Sbjct: 1 TAGRVAMEVESAKECVTTHLPKQLALKMDGAQASHLYRAV 40 Score = 39.9 bits (89), Expect = 0.003 Identities = 22/43 (51%), Positives = 26/43 (60%) Frame = +3 Query: 480 GRARRRAQKGLGVSPLGASVGADLGGSSKYSSEALED*RGEGF 608 GR R A G + +S ADLGGSSKYS+E+ ED GE F Sbjct: 51 GRGGRDAASGASLGETASS--ADLGGSSKYSNESFEDRSGERF 91 >SB_52007| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 86 Score = 54.4 bits (125), Expect = 1e-07 Identities = 38/82 (46%), Positives = 42/82 (51%) Frame = -1 Query: 413 IGKTLQRHPFSGLVASAGESLHTP*RIPTSMATVLLS*ATNAFHGVP*AFFRRLNTTFGS 234 IG TL+RHPFSGLVASA + TP F G LN FGS Sbjct: 24 IGATLERHPFSGLVASAEQP--TP------------------FVGSDERRLWHLNRAFGS 63 Query: 233 SHSASSAYQNWPTWHRHQISGF 168 S ASSAYQ WPT + H +SGF Sbjct: 64 SRIASSAYQKWPTRNSHSLSGF 85 >SB_9493| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 84 Score = 54.4 bits (125), Expect = 1e-07 Identities = 38/82 (46%), Positives = 42/82 (51%) Frame = -1 Query: 413 IGKTLQRHPFSGLVASAGESLHTP*RIPTSMATVLLS*ATNAFHGVP*AFFRRLNTTFGS 234 IG TL+RHPFSGLVASA + TP F G LN FGS Sbjct: 22 IGATLERHPFSGLVASAEQP--TP------------------FVGSDERRLWHLNRAFGS 61 Query: 233 SHSASSAYQNWPTWHRHQISGF 168 S ASSAYQ WPT + H +SGF Sbjct: 62 SRIASSAYQKWPTSNSHSLSGF 83 >SB_23689| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 172 Score = 52.8 bits (121), Expect = 3e-07 Identities = 27/53 (50%), Positives = 35/53 (66%) Frame = -1 Query: 623 TTVHAKPFSTSVLQGLAGVFATTTKICTDGGSKRAHAQTLLRSPSRTSYSLRL 465 T VH +PFSTSV + L +FATTTKICT G +A A+ + +P+ SYS L Sbjct: 113 TAVHMEPFSTSVFKALIRIFATTTKICTGGRFTQARARGCVTTPT-PSYSSEL 164 >SB_53289| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 100 Score = 52.4 bits (120), Expect = 4e-07 Identities = 25/33 (75%), Positives = 26/33 (78%) Frame = +2 Query: 326 KSESAKECATTHLPKQPALKMDGAEAFCLYTTV 424 K ESAKEC TTHLPKQ ALKMDGA+A LY V Sbjct: 9 KLESAKECVTTHLPKQLALKMDGAQASHLYRAV 41 Score = 39.9 bits (89), Expect = 0.003 Identities = 26/48 (54%), Positives = 31/48 (64%), Gaps = 7/48 (14%) Frame = +3 Query: 486 ARRRAQKGLGV--SPLGASVG-----ADLGGSSKYSSEALED*RGEGF 608 A+ R GLGV + GAS+G ADLGGSSKYS+E+ ED GE F Sbjct: 45 AKLRRVGGLGVRDAASGASLGETASSADLGGSSKYSNESFEDRSGERF 92 >SB_49224| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 93 Score = 52.4 bits (120), Expect = 4e-07 Identities = 25/33 (75%), Positives = 26/33 (78%) Frame = +2 Query: 326 KSESAKECATTHLPKQPALKMDGAEAFCLYTTV 424 K ESAKEC TTHLPKQ ALKMDGA+A LY V Sbjct: 2 KLESAKECVTTHLPKQLALKMDGAQASHLYRAV 34 Score = 39.9 bits (89), Expect = 0.003 Identities = 22/43 (51%), Positives = 26/43 (60%) Frame = +3 Query: 480 GRARRRAQKGLGVSPLGASVGADLGGSSKYSSEALED*RGEGF 608 GR R A G + +S ADLGGSSKYS+E+ ED GE F Sbjct: 45 GRGGRDAASGASLGETASS--ADLGGSSKYSNESFEDRSGERF 85 >SB_27353| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 93 Score = 52.4 bits (120), Expect = 4e-07 Identities = 25/33 (75%), Positives = 26/33 (78%) Frame = +2 Query: 326 KSESAKECATTHLPKQPALKMDGAEAFCLYTTV 424 K ESAKEC TTHLPKQ ALKMDGA+A LY V Sbjct: 2 KLESAKECVTTHLPKQLALKMDGAQASHLYRAV 34 Score = 39.9 bits (89), Expect = 0.003 Identities = 22/43 (51%), Positives = 26/43 (60%) Frame = +3 Query: 480 GRARRRAQKGLGVSPLGASVGADLGGSSKYSSEALED*RGEGF 608 GR R A G + +S ADLGGSSKYS+E+ ED GE F Sbjct: 45 GRGGRDAASGASLGETASS--ADLGGSSKYSNESFEDRSGERF 85 >SB_58055| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 93 Score = 51.2 bits (117), Expect = 1e-06 Identities = 24/31 (77%), Positives = 25/31 (80%) Frame = +2 Query: 332 ESAKECATTHLPKQPALKMDGAEAFCLYTTV 424 ESAKEC TTHLPKQ ALKMDGA+A LY V Sbjct: 4 ESAKECVTTHLPKQLALKMDGAQASHLYRAV 34 Score = 39.9 bits (89), Expect = 0.003 Identities = 22/43 (51%), Positives = 26/43 (60%) Frame = +3 Query: 480 GRARRRAQKGLGVSPLGASVGADLGGSSKYSSEALED*RGEGF 608 GR R A G + +S ADLGGSSKYS+E+ ED GE F Sbjct: 45 GRGGRDAASGASLGETASS--ADLGGSSKYSNESFEDRSGERF 85 >SB_54389| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 93 Score = 51.2 bits (117), Expect = 1e-06 Identities = 24/31 (77%), Positives = 25/31 (80%) Frame = +2 Query: 332 ESAKECATTHLPKQPALKMDGAEAFCLYTTV 424 ESAKEC TTHLPKQ ALKMDGA+A LY V Sbjct: 4 ESAKECVTTHLPKQLALKMDGAQASHLYRAV 34 Score = 39.9 bits (89), Expect = 0.003 Identities = 22/43 (51%), Positives = 26/43 (60%) Frame = +3 Query: 480 GRARRRAQKGLGVSPLGASVGADLGGSSKYSSEALED*RGEGF 608 GR R A G + +S ADLGGSSKYS+E+ ED GE F Sbjct: 45 GRGGRDAASGASLGETASS--ADLGGSSKYSNESFEDRSGERF 85 >SB_51835| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 93 Score = 51.2 bits (117), Expect = 1e-06 Identities = 24/31 (77%), Positives = 25/31 (80%) Frame = +2 Query: 332 ESAKECATTHLPKQPALKMDGAEAFCLYTTV 424 ESAKEC TTHLPKQ ALKMDGA+A LY V Sbjct: 4 ESAKECVTTHLPKQLALKMDGAQASHLYRAV 34 Score = 39.9 bits (89), Expect = 0.003 Identities = 22/43 (51%), Positives = 26/43 (60%) Frame = +3 Query: 480 GRARRRAQKGLGVSPLGASVGADLGGSSKYSSEALED*RGEGF 608 GR R A G + +S ADLGGSSKYS+E+ ED GE F Sbjct: 45 GRGGRDAASGASLGETASS--ADLGGSSKYSNESFEDRSGERF 85 >SB_48809| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 93 Score = 51.2 bits (117), Expect = 1e-06 Identities = 24/31 (77%), Positives = 25/31 (80%) Frame = +2 Query: 332 ESAKECATTHLPKQPALKMDGAEAFCLYTTV 424 ESAKEC TTHLPKQ ALKMDGA+A LY V Sbjct: 4 ESAKECVTTHLPKQLALKMDGAQASHLYRAV 34 Score = 39.9 bits (89), Expect = 0.003 Identities = 22/43 (51%), Positives = 26/43 (60%) Frame = +3 Query: 480 GRARRRAQKGLGVSPLGASVGADLGGSSKYSSEALED*RGEGF 608 GR R A G + +S ADLGGSSKYS+E+ ED GE F Sbjct: 45 GRGGRDAASGASLGETASS--ADLGGSSKYSNESFEDRSGERF 85 >SB_41857| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 93 Score = 51.2 bits (117), Expect = 1e-06 Identities = 24/31 (77%), Positives = 25/31 (80%) Frame = +2 Query: 332 ESAKECATTHLPKQPALKMDGAEAFCLYTTV 424 ESAKEC TTHLPKQ ALKMDGA+A LY V Sbjct: 4 ESAKECVTTHLPKQLALKMDGAQASHLYRAV 34 Score = 39.9 bits (89), Expect = 0.003 Identities = 22/43 (51%), Positives = 26/43 (60%) Frame = +3 Query: 480 GRARRRAQKGLGVSPLGASVGADLGGSSKYSSEALED*RGEGF 608 GR R A G + +S ADLGGSSKYS+E+ ED GE F Sbjct: 45 GRGGRDAASGASLGETASS--ADLGGSSKYSNESFEDRSGERF 85 >SB_40886| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 93 Score = 51.2 bits (117), Expect = 1e-06 Identities = 24/31 (77%), Positives = 25/31 (80%) Frame = +2 Query: 332 ESAKECATTHLPKQPALKMDGAEAFCLYTTV 424 ESAKEC TTHLPKQ ALKMDGA+A LY V Sbjct: 4 ESAKECVTTHLPKQLALKMDGAQASHLYRAV 34 Score = 39.9 bits (89), Expect = 0.003 Identities = 22/43 (51%), Positives = 26/43 (60%) Frame = +3 Query: 480 GRARRRAQKGLGVSPLGASVGADLGGSSKYSSEALED*RGEGF 608 GR R A G + +S ADLGGSSKYS+E+ ED GE F Sbjct: 45 GRGGRDAASGASLGETASS--ADLGGSSKYSNESFEDRSGERF 85 >SB_40435| Best HMM Match : DUF1677 (HMM E-Value=4.2) Length = 93 Score = 51.2 bits (117), Expect = 1e-06 Identities = 24/31 (77%), Positives = 25/31 (80%) Frame = +2 Query: 332 ESAKECATTHLPKQPALKMDGAEAFCLYTTV 424 ESAKEC TTHLPKQ ALKMDGA+A LY V Sbjct: 4 ESAKECVTTHLPKQLALKMDGAQASHLYRAV 34 Score = 39.5 bits (88), Expect = 0.003 Identities = 23/47 (48%), Positives = 30/47 (63%), Gaps = 5/47 (10%) Frame = +3 Query: 483 RARRRAQKGLGVSPLGASVG-----ADLGGSSKYSSEALED*RGEGF 608 + RR +G+ + GAS+G ADLGGSSKYS+E+ ED GE F Sbjct: 39 KLRRVGGRGVRDAASGASLGETASSADLGGSSKYSNESFEDRSGERF 85 >SB_9214| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 93 Score = 51.2 bits (117), Expect = 1e-06 Identities = 24/31 (77%), Positives = 25/31 (80%) Frame = +2 Query: 332 ESAKECATTHLPKQPALKMDGAEAFCLYTTV 424 ESAKEC TTHLPKQ ALKMDGA+A LY V Sbjct: 4 ESAKECVTTHLPKQLALKMDGAQASHLYRAV 34 Score = 39.9 bits (89), Expect = 0.003 Identities = 22/43 (51%), Positives = 26/43 (60%) Frame = +3 Query: 480 GRARRRAQKGLGVSPLGASVGADLGGSSKYSSEALED*RGEGF 608 GR R A G + +S ADLGGSSKYS+E+ ED GE F Sbjct: 45 GRGGRDAASGASLGETASS--ADLGGSSKYSNESFEDRSGERF 85 >SB_5959| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 93 Score = 51.2 bits (117), Expect = 1e-06 Identities = 24/31 (77%), Positives = 25/31 (80%) Frame = +2 Query: 332 ESAKECATTHLPKQPALKMDGAEAFCLYTTV 424 ESAKEC TTHLPKQ ALKMDGA+A LY V Sbjct: 4 ESAKECVTTHLPKQLALKMDGAQASHLYRAV 34 Score = 39.9 bits (89), Expect = 0.003 Identities = 22/43 (51%), Positives = 26/43 (60%) Frame = +3 Query: 480 GRARRRAQKGLGVSPLGASVGADLGGSSKYSSEALED*RGEGF 608 GR R A G + +S ADLGGSSKYS+E+ ED GE F Sbjct: 45 GRGGRDAASGASLGETASS--ADLGGSSKYSNESFEDRSGERF 85 >SB_3984| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 97 Score = 51.2 bits (117), Expect = 1e-06 Identities = 24/31 (77%), Positives = 25/31 (80%) Frame = +2 Query: 332 ESAKECATTHLPKQPALKMDGAEAFCLYTTV 424 ESAKEC TTHLPKQ ALKMDGA+A LY V Sbjct: 4 ESAKECVTTHLPKQLALKMDGAQASHLYRAV 34 Score = 39.9 bits (89), Expect = 0.003 Identities = 22/43 (51%), Positives = 26/43 (60%) Frame = +3 Query: 480 GRARRRAQKGLGVSPLGASVGADLGGSSKYSSEALED*RGEGF 608 GR R A G + +S ADLGGSSKYS+E+ ED GE F Sbjct: 45 GRGGRDAASGASLGETASS--ADLGGSSKYSNESFEDRSGERF 85 >SB_47626| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 99 Score = 51.2 bits (117), Expect = 1e-06 Identities = 24/31 (77%), Positives = 25/31 (80%) Frame = +2 Query: 332 ESAKECATTHLPKQPALKMDGAEAFCLYTTV 424 ESAKEC TTHLPKQ ALKMDGA+A LY V Sbjct: 10 ESAKECVTTHLPKQLALKMDGAQASHLYRAV 40 Score = 39.9 bits (89), Expect = 0.003 Identities = 22/43 (51%), Positives = 26/43 (60%) Frame = +3 Query: 480 GRARRRAQKGLGVSPLGASVGADLGGSSKYSSEALED*RGEGF 608 GR R A G + +S ADLGGSSKYS+E+ ED GE F Sbjct: 51 GRGGRDAASGASLGETASS--ADLGGSSKYSNESFEDRSGERF 91 >SB_27272| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 154 Score = 50.8 bits (116), Expect = 1e-06 Identities = 25/34 (73%), Positives = 27/34 (79%) Frame = -2 Query: 643 DRLTREQLLFTRNPSPRQSSRASLEYLLLPPRSA 542 DRLT QLLFT N SP +SS+ S EYLLLPPRSA Sbjct: 89 DRLTHVQLLFTWNLSPLRSSKLSFEYLLLPPRSA 122 >SB_55300| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 93 Score = 49.2 bits (112), Expect = 4e-06 Identities = 23/30 (76%), Positives = 24/30 (80%) Frame = +2 Query: 335 SAKECATTHLPKQPALKMDGAEAFCLYTTV 424 SAKEC TTHLPKQ ALKMDGA+A LY V Sbjct: 5 SAKECVTTHLPKQLALKMDGAQASHLYRAV 34 Score = 39.9 bits (89), Expect = 0.003 Identities = 22/43 (51%), Positives = 26/43 (60%) Frame = +3 Query: 480 GRARRRAQKGLGVSPLGASVGADLGGSSKYSSEALED*RGEGF 608 GR R A G + +S ADLGGSSKYS+E+ ED GE F Sbjct: 45 GRGGRDAASGASLGETASS--ADLGGSSKYSNESFEDRSGERF 85 >SB_53216| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 93 Score = 49.2 bits (112), Expect = 4e-06 Identities = 23/30 (76%), Positives = 24/30 (80%) Frame = +2 Query: 335 SAKECATTHLPKQPALKMDGAEAFCLYTTV 424 SAKEC TTHLPKQ ALKMDGA+A LY V Sbjct: 5 SAKECVTTHLPKQLALKMDGAQASHLYRAV 34 Score = 39.9 bits (89), Expect = 0.003 Identities = 22/43 (51%), Positives = 26/43 (60%) Frame = +3 Query: 480 GRARRRAQKGLGVSPLGASVGADLGGSSKYSSEALED*RGEGF 608 GR R A G + +S ADLGGSSKYS+E+ ED GE F Sbjct: 45 GRGGRDAASGASLGETASS--ADLGGSSKYSNESFEDRSGERF 85 >SB_24856| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 93 Score = 49.2 bits (112), Expect = 4e-06 Identities = 23/30 (76%), Positives = 24/30 (80%) Frame = +2 Query: 335 SAKECATTHLPKQPALKMDGAEAFCLYTTV 424 SAKEC TTHLPKQ ALKMDGA+A LY V Sbjct: 5 SAKECVTTHLPKQLALKMDGAQASHLYRAV 34 Score = 39.9 bits (89), Expect = 0.003 Identities = 22/43 (51%), Positives = 26/43 (60%) Frame = +3 Query: 480 GRARRRAQKGLGVSPLGASVGADLGGSSKYSSEALED*RGEGF 608 GR R A G + +S ADLGGSSKYS+E+ ED GE F Sbjct: 45 GRGGRDAASGASLGETASS--ADLGGSSKYSNESFEDRSGERF 85 >SB_16637| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 93 Score = 49.2 bits (112), Expect = 4e-06 Identities = 23/30 (76%), Positives = 24/30 (80%) Frame = +2 Query: 335 SAKECATTHLPKQPALKMDGAEAFCLYTTV 424 SAKEC TTHLPKQ ALKMDGA+A LY V Sbjct: 5 SAKECVTTHLPKQLALKMDGAQASHLYRAV 34 Score = 39.9 bits (89), Expect = 0.003 Identities = 22/43 (51%), Positives = 26/43 (60%) Frame = +3 Query: 480 GRARRRAQKGLGVSPLGASVGADLGGSSKYSSEALED*RGEGF 608 GR R A G + +S ADLGGSSKYS+E+ ED GE F Sbjct: 45 GRGGRDAASGASLGETASS--ADLGGSSKYSNESFEDRSGERF 85 >SB_19053| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 57 Score = 49.2 bits (112), Expect = 4e-06 Identities = 24/41 (58%), Positives = 28/41 (68%) Frame = -1 Query: 254 LNTTFGSSHSASSAYQNWPTWHRHQISGFIVRVSRSSHPFK 132 LN FGSS ASSAYQ WPT + H +SGF SR+S+ FK Sbjct: 17 LNRAFGSSRIASSAYQKWPTRNSHSLSGFNY-ASRTSYQFK 56 >SB_35257| Best HMM Match : Sec8_exocyst (HMM E-Value=0.59) Length = 1060 Score = 47.6 bits (108), Expect = 1e-05 Identities = 23/37 (62%), Positives = 26/37 (70%) Frame = +3 Query: 249 VKAPKKRSWDTMKGVGRS*QQDGGHGSRNPLRSVQRL 359 ++ +RS D KGVG S QQDGGHGS NPLR QRL Sbjct: 9 LRCQSRRSSDPTKGVGCSRQQDGGHGSWNPLRKGQRL 45 >SB_40315| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 83 Score = 44.8 bits (101), Expect = 9e-05 Identities = 19/29 (65%), Positives = 21/29 (72%) Frame = -1 Query: 254 LNTTFGSSHSASSAYQNWPTWHRHQISGF 168 LN FGSS ASSAYQ WPT + H +SGF Sbjct: 54 LNRAFGSSRIASSAYQKWPTRNSHSLSGF 82 >SB_32500| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 46 Score = 44.8 bits (101), Expect = 9e-05 Identities = 19/29 (65%), Positives = 21/29 (72%) Frame = -1 Query: 254 LNTTFGSSHSASSAYQNWPTWHRHQISGF 168 LN FGSS ASSAYQ WPT + H +SGF Sbjct: 17 LNRAFGSSRIASSAYQKWPTRNSHSLSGF 45 >SB_24543| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 46 Score = 44.8 bits (101), Expect = 9e-05 Identities = 19/29 (65%), Positives = 21/29 (72%) Frame = -1 Query: 254 LNTTFGSSHSASSAYQNWPTWHRHQISGF 168 LN FGSS ASSAYQ WPT + H +SGF Sbjct: 17 LNRAFGSSRIASSAYQKWPTRNSHSLSGF 45 >SB_20448| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 84 Score = 44.8 bits (101), Expect = 9e-05 Identities = 19/29 (65%), Positives = 21/29 (72%) Frame = -1 Query: 254 LNTTFGSSHSASSAYQNWPTWHRHQISGF 168 LN FGSS ASSAYQ WPT + H +SGF Sbjct: 55 LNRAFGSSRIASSAYQKWPTRNSHSLSGF 83 >SB_5288| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 71 Score = 44.8 bits (101), Expect = 9e-05 Identities = 19/29 (65%), Positives = 21/29 (72%) Frame = -1 Query: 254 LNTTFGSSHSASSAYQNWPTWHRHQISGF 168 LN FGSS ASSAYQ WPT + H +SGF Sbjct: 17 LNRAFGSSRIASSAYQKWPTRNSHSLSGF 45 >SB_4968| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 46 Score = 44.8 bits (101), Expect = 9e-05 Identities = 19/29 (65%), Positives = 21/29 (72%) Frame = -1 Query: 254 LNTTFGSSHSASSAYQNWPTWHRHQISGF 168 LN FGSS ASSAYQ WPT + H +SGF Sbjct: 17 LNRAFGSSRIASSAYQKWPTRNSHSLSGF 45 >SB_3995| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 46 Score = 44.8 bits (101), Expect = 9e-05 Identities = 19/29 (65%), Positives = 21/29 (72%) Frame = -1 Query: 254 LNTTFGSSHSASSAYQNWPTWHRHQISGF 168 LN FGSS ASSAYQ WPT + H +SGF Sbjct: 17 LNRAFGSSRIASSAYQKWPTKNSHSLSGF 45 >SB_1350| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 54 Score = 44.8 bits (101), Expect = 9e-05 Identities = 19/29 (65%), Positives = 21/29 (72%) Frame = -1 Query: 254 LNTTFGSSHSASSAYQNWPTWHRHQISGF 168 LN FGSS ASSAYQ WPT + H +SGF Sbjct: 17 LNRAFGSSRIASSAYQKWPTRNSHSLSGF 45 >SB_59236| Best HMM Match : Attractin (HMM E-Value=8.2) Length = 125 Score = 44.8 bits (101), Expect = 9e-05 Identities = 19/29 (65%), Positives = 21/29 (72%) Frame = -1 Query: 254 LNTTFGSSHSASSAYQNWPTWHRHQISGF 168 LN FGSS ASSAYQ WPT + H +SGF Sbjct: 96 LNRAFGSSRIASSAYQKWPTRNSHSLSGF 124 >SB_53668| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 46 Score = 44.8 bits (101), Expect = 9e-05 Identities = 19/29 (65%), Positives = 21/29 (72%) Frame = -1 Query: 254 LNTTFGSSHSASSAYQNWPTWHRHQISGF 168 LN FGSS ASSAYQ WPT + H +SGF Sbjct: 17 LNRAFGSSRIASSAYQKWPTRNSHSLSGF 45 >SB_53194| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 46 Score = 44.8 bits (101), Expect = 9e-05 Identities = 19/29 (65%), Positives = 21/29 (72%) Frame = -1 Query: 254 LNTTFGSSHSASSAYQNWPTWHRHQISGF 168 LN FGSS ASSAYQ WPT + H +SGF Sbjct: 17 LNRAFGSSRIASSAYQKWPTRNSHSLSGF 45 >SB_47973| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 46 Score = 44.8 bits (101), Expect = 9e-05 Identities = 19/29 (65%), Positives = 21/29 (72%) Frame = -1 Query: 254 LNTTFGSSHSASSAYQNWPTWHRHQISGF 168 LN FGSS ASSAYQ WPT + H +SGF Sbjct: 17 LNRAFGSSRIASSAYQKWPTRNSHSLSGF 45 >SB_40285| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 46 Score = 44.8 bits (101), Expect = 9e-05 Identities = 19/29 (65%), Positives = 21/29 (72%) Frame = -1 Query: 254 LNTTFGSSHSASSAYQNWPTWHRHQISGF 168 LN FGSS ASSAYQ WPT + H +SGF Sbjct: 17 LNRAFGSSRIASSAYQKWPTRNSHSLSGF 45 >SB_16426| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 46 Score = 44.8 bits (101), Expect = 9e-05 Identities = 19/29 (65%), Positives = 21/29 (72%) Frame = -1 Query: 254 LNTTFGSSHSASSAYQNWPTWHRHQISGF 168 LN FGSS ASSAYQ WPT + H +SGF Sbjct: 17 LNRAFGSSRIASSAYQKWPTRNSHSLSGF 45 >SB_15603| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 168 Score = 44.8 bits (101), Expect = 9e-05 Identities = 19/29 (65%), Positives = 21/29 (72%) Frame = -1 Query: 254 LNTTFGSSHSASSAYQNWPTWHRHQISGF 168 LN FGSS ASSAYQ WPT + H +SGF Sbjct: 139 LNRAFGSSRIASSAYQKWPTRNSHSLSGF 167 >SB_19187| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 46 Score = 44.4 bits (100), Expect = 1e-04 Identities = 19/29 (65%), Positives = 21/29 (72%) Frame = -1 Query: 254 LNTTFGSSHSASSAYQNWPTWHRHQISGF 168 LN FGSS ASSAYQ WPT + H +SGF Sbjct: 17 LNHAFGSSRIASSAYQKWPTRNSHSLSGF 45 >SB_161| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 46 Score = 43.6 bits (98), Expect = 2e-04 Identities = 18/29 (62%), Positives = 21/29 (72%) Frame = -1 Query: 254 LNTTFGSSHSASSAYQNWPTWHRHQISGF 168 LN +GSS ASSAYQ WPT + H +SGF Sbjct: 17 LNRAYGSSRIASSAYQKWPTRNSHSLSGF 45 >SB_11440| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 103 Score = 41.5 bits (93), Expect = 8e-04 Identities = 18/29 (62%), Positives = 20/29 (68%) Frame = -1 Query: 254 LNTTFGSSHSASSAYQNWPTWHRHQISGF 168 LN FGSS ASSA Q WPT + H +SGF Sbjct: 74 LNRAFGSSRIASSALQKWPTRNSHSLSGF 102 >SB_18857| Best HMM Match : Gln-synt_N (HMM E-Value=1.5) Length = 164 Score = 41.5 bits (93), Expect = 8e-04 Identities = 20/45 (44%), Positives = 26/45 (57%) Frame = -1 Query: 623 TTVHAKPFSTSVLQGLAGVFATTTKICTDGGSKRAHAQTLLRSPS 489 T VH PFSTS Q L +FATTTKIC G + + + +P+ Sbjct: 48 TAVHMDPFSTSGFQALILIFATTTKICPGGRFTQGSGKGWVTTPT 92 >SB_29359| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 33 Score = 40.3 bits (90), Expect = 0.002 Identities = 20/25 (80%), Positives = 21/25 (84%) Frame = +1 Query: 265 NAHGTP*KALVAHDSRTVAMEVGIR 339 +AH TP K LVA DSRTVAMEVGIR Sbjct: 9 DAHQTPQKVLVALDSRTVAMEVGIR 33 >SB_24059| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 42 Score = 39.9 bits (89), Expect = 0.003 Identities = 18/21 (85%), Positives = 18/21 (85%) Frame = +2 Query: 326 KSESAKECATTHLPKQPALKM 388 K ESAKEC TTHLPKQ ALKM Sbjct: 2 KVESAKECVTTHLPKQLALKM 22 >SB_40592| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 46 Score = 39.5 bits (88), Expect = 0.003 Identities = 18/29 (62%), Positives = 20/29 (68%) Frame = -1 Query: 254 LNTTFGSSHSASSAYQNWPTWHRHQISGF 168 LN FGSS ASSAYQ PT + H +SGF Sbjct: 17 LNRAFGSSRIASSAYQKGPTRNSHSLSGF 45 >SB_9995| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 38.3 bits (85), Expect = 0.008 Identities = 16/26 (61%), Positives = 18/26 (69%) Frame = -1 Query: 254 LNTTFGSSHSASSAYQNWPTWHRHQI 177 LN FGSS ASSAYQ WPT + H + Sbjct: 17 LNRAFGSSRIASSAYQKWPTRNSHSL 42 >SB_24609| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 35.5 bits (78), Expect = 0.055 Identities = 15/20 (75%), Positives = 15/20 (75%) Frame = -1 Query: 254 LNTTFGSSHSASSAYQNWPT 195 LN FGSS ASSAYQ WPT Sbjct: 17 LNRAFGSSRIASSAYQKWPT 36 >SB_18772| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 64 Score = 33.9 bits (74), Expect = 0.17 Identities = 17/29 (58%), Positives = 21/29 (72%) Frame = +1 Query: 520 ARLEPPSVQILVVVANTPARPWRTDVEKG 606 A ++ P VQILVVVAN R +T+VEKG Sbjct: 34 AWVKRPPVQILVVVANIQMRALKTEVEKG 62 >SB_20402| Best HMM Match : Transformer (HMM E-Value=2.1) Length = 276 Score = 32.3 bits (70), Expect = 0.51 Identities = 27/68 (39%), Positives = 35/68 (51%), Gaps = 7/68 (10%) Frame = -2 Query: 301 ERPTPFMVSHERFLGALTLRLVHPTAPVLLTKI-------GPLGTVIRSPASSFE*AGVL 143 E+PTPF+ S ER RL HP ++I GP T I P + + G+L Sbjct: 58 EQPTPFVGSDER-------RLWHPYRAFGSSRIASSGYQNGPTRTRIHCPGFNKQ-VGLL 109 Query: 142 THLKFENR 119 T+LKFENR Sbjct: 110 TNLKFENR 117 Score = 30.3 bits (65), Expect = 2.1 Identities = 15/25 (60%), Positives = 15/25 (60%) Frame = -1 Query: 242 FGSSHSASSAYQNWPTWHRHQISGF 168 FGSS ASS YQN PT R GF Sbjct: 78 FGSSRIASSGYQNGPTRTRIHCPGF 102 >SB_6844| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 54 Score = 30.7 bits (66), Expect = 1.6 Identities = 14/19 (73%), Positives = 14/19 (73%) Frame = -1 Query: 254 LNTTFGSSHSASSAYQNWP 198 LN FGSS ASSAYQN P Sbjct: 17 LNRAFGSSRIASSAYQNGP 35 Score = 28.7 bits (61), Expect = 6.3 Identities = 18/44 (40%), Positives = 21/44 (47%) Frame = -2 Query: 298 RPTPFMVSHERFLGALTLRLVHPTAPVLLTKIGPLGTVIRSPAS 167 +PTPF+ S ER L L + GPLGT I PAS Sbjct: 2 QPTPFVGSDERRLWHLNRAFGSSRIASSAYQNGPLGTRIHCPAS 45 >SB_50854| Best HMM Match : ig (HMM E-Value=6.1e-27) Length = 770 Score = 29.9 bits (64), Expect = 2.7 Identities = 20/51 (39%), Positives = 24/51 (47%) Frame = -1 Query: 614 HAKPFSTSVLQGLAGVFATTTKICTDGGSKRAHAQTLLRSPSRTSYSLRLN 462 HA F V GL G+ AT +I T GS R ++ P RTS L N Sbjct: 410 HATTFLVVVGHGLPGIQATRPRIKTTAGS-RCVLNCIVTLPPRTSVILSWN 459 >SB_39247| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 148 Score = 29.5 bits (63), Expect = 3.6 Identities = 16/43 (37%), Positives = 21/43 (48%) Frame = -3 Query: 696 KNYKKTRHIDIRSLLELRID*LASNYCSRETLLHVSPPGPRWS 568 +N K RH+ + D L+SN CS L + P PRWS Sbjct: 2 ENNKTVRHLGRHFTGHAKNDALSSNSCSPGDPLVLERPPPRWS 44 >SB_37973| Best HMM Match : ABC_tran (HMM E-Value=0) Length = 3369 Score = 29.1 bits (62), Expect = 4.8 Identities = 12/32 (37%), Positives = 20/32 (62%) Frame = -3 Query: 357 VVAHSLADSDFHGHRPAVMSDQRLSWCPMSVF 262 + H + ++DF G R A+M+D +L C S+F Sbjct: 386 LTTHFMDEADFLGDRIAIMADGQLRCCGSSLF 417 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 28,260,850 Number of Sequences: 59808 Number of extensions: 621234 Number of successful extensions: 2381 Number of sequences better than 10.0: 60 Number of HSP's better than 10.0 without gapping: 2201 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2379 length of database: 16,821,457 effective HSP length: 81 effective length of database: 11,977,009 effective search space used: 2407378809 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -