BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= FWDP01_FL5_M11 (848 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AB047034-1|BAB64310.1| 1598|Apis mellifera mblk-1 protein. 25 0.67 AB161182-1|BAD08344.1| 1040|Apis mellifera metabotropic glutamat... 24 1.5 AF388659-1|AAK71995.1| 782|Apis mellifera 1D-myo-inositol-trisp... 23 2.7 AF084556-1|AAC71015.1| 652|Apis mellifera pipsqueak protein. 22 8.2 >AB047034-1|BAB64310.1| 1598|Apis mellifera mblk-1 protein. Length = 1598 Score = 25.4 bits (53), Expect = 0.67 Identities = 9/22 (40%), Positives = 14/22 (63%) Frame = +3 Query: 162 NDEAGDLMTVPSGPILVSRTGA 227 ND+ D +T P P+ +SR G+ Sbjct: 1387 NDDGSDRLTSPPTPLSISRAGS 1408 >AB161182-1|BAD08344.1| 1040|Apis mellifera metabotropic glutamate receptor protein. Length = 1040 Score = 24.2 bits (50), Expect = 1.5 Identities = 8/15 (53%), Positives = 9/15 (60%) Frame = +1 Query: 349 CNDSPAEATSPENGW 393 C D P E PE+GW Sbjct: 642 CRDIPEEFLRPESGW 656 >AF388659-1|AAK71995.1| 782|Apis mellifera 1D-myo-inositol-trisphosphate 3-kinaseisoform A protein. Length = 782 Score = 23.4 bits (48), Expect = 2.7 Identities = 17/52 (32%), Positives = 25/52 (48%) Frame = -2 Query: 178 SPASSFE*AGVLTHLKFENRLRSFRPQCL*SFALPDETVLKFYIDASYPEGN 23 S A+S E + TH + ++LR R S L DE K + ++ EGN Sbjct: 220 STAASDEDISLTTHQQKRHKLRVTRCYSSDSAVLSDEDQTKGWDGSNMVEGN 271 >AF084556-1|AAC71015.1| 652|Apis mellifera pipsqueak protein. Length = 652 Score = 21.8 bits (44), Expect = 8.2 Identities = 14/38 (36%), Positives = 18/38 (47%) Frame = -1 Query: 548 ICTDGGSKRAHAQTLLRSPSRTSYSLRLNDTKLKI*HH 435 +C S+ L SP R + R+N TKLK HH Sbjct: 120 LCEVPESRDGPPSVSLSSPPREPGTPRINFTKLKR-HH 156 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 251,832 Number of Sequences: 438 Number of extensions: 6201 Number of successful extensions: 8 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 8 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 8 length of database: 146,343 effective HSP length: 57 effective length of database: 121,377 effective search space used: 27309825 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -