BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= FWDP01_FL5_M10 (842 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_48657| Best HMM Match : GST_C (HMM E-Value=5.8e-07) 136 2e-32 SB_19860| Best HMM Match : GST_C (HMM E-Value=9.6e-10) 40 0.003 SB_13078| Best HMM Match : RVP (HMM E-Value=0.039) 31 0.89 SB_51018| Best HMM Match : RVT_1 (HMM E-Value=5.8e-17) 31 1.5 SB_28788| Best HMM Match : RVP (HMM E-Value=0.028) 31 1.5 SB_23218| Best HMM Match : zf-CCHC (HMM E-Value=0.00066) 31 1.5 SB_12598| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.5 SB_8572| Best HMM Match : RVT_1 (HMM E-Value=5.6e-17) 31 1.5 SB_7437| Best HMM Match : PAS (HMM E-Value=7.2e-14) 31 1.5 SB_3903| Best HMM Match : RVT_1 (HMM E-Value=4.5e-17) 31 1.5 SB_860| Best HMM Match : RVP (HMM E-Value=0.018) 31 1.5 SB_50204| Best HMM Match : rve (HMM E-Value=6.6e-22) 31 1.5 SB_46473| Best HMM Match : RVP (HMM E-Value=0.029) 31 1.5 SB_29974| Best HMM Match : RVT_1 (HMM E-Value=3e-17) 31 1.5 SB_27267| Best HMM Match : RVT_1 (HMM E-Value=5.6e-17) 31 1.5 SB_8937| Best HMM Match : RVP (HMM E-Value=0.029) 31 1.5 SB_4291| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.5 SB_59190| Best HMM Match : rve (HMM E-Value=6e-18) 30 2.0 SB_42289| Best HMM Match : RVT_1 (HMM E-Value=5.2e-17) 30 2.0 SB_45212| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.7 SB_37850| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.6 SB_16159| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.7 SB_25676| Best HMM Match : TSP_1 (HMM E-Value=0.0055) 29 4.7 SB_52428| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.2 SB_36561| Best HMM Match : BACK (HMM E-Value=1.4013e-45) 29 6.2 SB_16289| Best HMM Match : Phage_integrase (HMM E-Value=0.4) 29 6.2 SB_51364| Best HMM Match : DUF1431 (HMM E-Value=5.9) 29 6.2 SB_39324| Best HMM Match : S-antigen (HMM E-Value=1.2) 29 6.2 >SB_48657| Best HMM Match : GST_C (HMM E-Value=5.8e-07) Length = 203 Score = 136 bits (329), Expect = 2e-32 Identities = 76/162 (46%), Positives = 103/162 (63%) Frame = +2 Query: 26 MAAGVLYTYPENFRAYKALIAAQYSGTDVKVAPNFVFGETNKSEDFLKKFPAGKVPAFES 205 MAAG LYTYP++FRA K LIAA+YSGT ++V P F FG+ N + +FLKKFP GKVPAFE+ Sbjct: 1 MAAGKLYTYPDSFRAQKILIAAEYSGTKIEV-PAFTFGKDNHTAEFLKKFPLGKVPAFET 59 Query: 206 ADGKVLLTESNAIAYYVANESLRGGDLATQARVWQWASWSDSELLPASCAWVFPYLGIMQ 385 AN R L T + +++D ELLPA+ WVFP G+MQ Sbjct: 60 K---------------TANACTRAMPLLTT-----YVNFADQELLPAAATWVFPTYGMMQ 99 Query: 386 FNKQNVERAKSDLLAALKVLDGHLLTRTFLVTERITLADVIV 511 ++KQ+ ++A D+ + +L+ LL +TFLV ER+TLAD+ V Sbjct: 100 YHKQSTDKAMEDVKKYMTMLNDVLLMKTFLVGERVTLADIAV 141 >SB_19860| Best HMM Match : GST_C (HMM E-Value=9.6e-10) Length = 260 Score = 39.9 bits (89), Expect = 0.003 Identities = 37/132 (28%), Positives = 59/132 (44%), Gaps = 4/132 (3%) Frame = +2 Query: 176 PAGKVPAFESADGKVLLTESNAIAYYVA--NESLRGGDLATQARVWQWASWSDSELLPAS 349 P +P E+ +G SN I Y+A ++ L G DL + +V QW + + A Sbjct: 45 PFNTLPLLETKEGTFF--SSNTIIRYLAASSDKLYGSDLFQRGQVDQWLDITTCDFEAAV 102 Query: 350 CAWVFPYLGIMQFNKQNVERAK--SDLLAALKVLDGHLLTRTFLVTERITLADVIVFSXT 523 A G ++VE AK +D+ L ++ HL R FLV + +T+AD V + Sbjct: 103 AAVAIAKEG------RDVEGAKIVADINKFLGFVEKHLAGRKFLVGDSVTIADFSVATSI 156 Query: 524 AACFPARARPER 559 A + +R Sbjct: 157 AVILTSLGDEDR 168 >SB_13078| Best HMM Match : RVP (HMM E-Value=0.039) Length = 251 Score = 31.5 bits (68), Expect = 0.89 Identities = 15/49 (30%), Positives = 27/49 (55%) Frame = +3 Query: 387 STNRMLNVQSLTYWPP*KYWTDIFSHAPSLLPRESHLPMSLSSVTLLHA 533 S ++ + +LT P K + D FS+ P +LP + HL + + ++HA Sbjct: 165 SREQIKSTTTLTSDPVLKDYLDCFSNKPGMLPNKVHLEVDSAVTPVIHA 213 >SB_51018| Best HMM Match : RVT_1 (HMM E-Value=5.8e-17) Length = 635 Score = 30.7 bits (66), Expect = 1.5 Identities = 15/49 (30%), Positives = 26/49 (53%) Frame = +3 Query: 387 STNRMLNVQSLTYWPP*KYWTDIFSHAPSLLPRESHLPMSLSSVTLLHA 533 S + + +LT P K + D FS+ P +LP + HL + + ++HA Sbjct: 113 SREQSKSTTTLTSDPVLKDYLDCFSNKPGMLPNKVHLEVDSAVTPVIHA 161 >SB_28788| Best HMM Match : RVP (HMM E-Value=0.028) Length = 278 Score = 30.7 bits (66), Expect = 1.5 Identities = 15/49 (30%), Positives = 26/49 (53%) Frame = +3 Query: 387 STNRMLNVQSLTYWPP*KYWTDIFSHAPSLLPRESHLPMSLSSVTLLHA 533 S + + +LT P K + D FS+ P +LP + HL + + ++HA Sbjct: 165 SREQSKSTTTLTSDPVLKDYLDCFSNKPGMLPNKVHLEVDSAVTPVIHA 213 >SB_23218| Best HMM Match : zf-CCHC (HMM E-Value=0.00066) Length = 557 Score = 30.7 bits (66), Expect = 1.5 Identities = 15/49 (30%), Positives = 26/49 (53%) Frame = +3 Query: 387 STNRMLNVQSLTYWPP*KYWTDIFSHAPSLLPRESHLPMSLSSVTLLHA 533 S + + +LT P K + D FS+ P +LP + HL + + ++HA Sbjct: 386 SREQSKSTTTLTSDPVLKDYLDCFSNKPGMLPNKVHLEVDSAVTPVIHA 434 >SB_12598| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 799 Score = 30.7 bits (66), Expect = 1.5 Identities = 15/49 (30%), Positives = 26/49 (53%) Frame = +3 Query: 387 STNRMLNVQSLTYWPP*KYWTDIFSHAPSLLPRESHLPMSLSSVTLLHA 533 S + + +LT P K + D FS+ P +LP + HL + + ++HA Sbjct: 165 SREQSKSTTTLTSDPVLKDYLDCFSNKPGMLPNKVHLEVDSAVTPVIHA 213 >SB_8572| Best HMM Match : RVT_1 (HMM E-Value=5.6e-17) Length = 1432 Score = 30.7 bits (66), Expect = 1.5 Identities = 15/49 (30%), Positives = 26/49 (53%) Frame = +3 Query: 387 STNRMLNVQSLTYWPP*KYWTDIFSHAPSLLPRESHLPMSLSSVTLLHA 533 S + + +LT P K + D FS+ P +LP + HL + + ++HA Sbjct: 281 SREQSKSTTTLTSDPVLKDYLDCFSNKPGMLPNKVHLEVDSAVTPVIHA 329 >SB_7437| Best HMM Match : PAS (HMM E-Value=7.2e-14) Length = 505 Score = 30.7 bits (66), Expect = 1.5 Identities = 18/71 (25%), Positives = 30/71 (42%) Frame = +2 Query: 59 NFRAYKALIAAQYSGTDVKVAPNFVFGETNKSEDFLKKFPAGKVPAFESADGKVLLTESN 238 N +K + Q + K+ P V GE N + +KK +P GK + + + Sbjct: 105 NIGKFKMVWIDQIDESTKKLKPKMVAGEDNGFVNAIKKVSLEDIPEGNGPSGKAIREKRS 164 Query: 239 AIAYYVANESL 271 I + N+SL Sbjct: 165 IIVNDIENDSL 175 >SB_3903| Best HMM Match : RVT_1 (HMM E-Value=4.5e-17) Length = 609 Score = 30.7 bits (66), Expect = 1.5 Identities = 15/49 (30%), Positives = 26/49 (53%) Frame = +3 Query: 387 STNRMLNVQSLTYWPP*KYWTDIFSHAPSLLPRESHLPMSLSSVTLLHA 533 S + + +LT P K + D FS+ P +LP + HL + + ++HA Sbjct: 303 SREQSKSTTTLTSDPVLKDYLDCFSNKPGMLPNKVHLEVDSAVTPVIHA 351 >SB_860| Best HMM Match : RVP (HMM E-Value=0.018) Length = 260 Score = 30.7 bits (66), Expect = 1.5 Identities = 15/49 (30%), Positives = 26/49 (53%) Frame = +3 Query: 387 STNRMLNVQSLTYWPP*KYWTDIFSHAPSLLPRESHLPMSLSSVTLLHA 533 S + + +LT P K + D FS+ P +LP + HL + + ++HA Sbjct: 147 SREQSKSTTTLTSDPVLKDYLDCFSNKPGMLPNKVHLEVDSAVTPVIHA 195 >SB_50204| Best HMM Match : rve (HMM E-Value=6.6e-22) Length = 800 Score = 30.7 bits (66), Expect = 1.5 Identities = 15/49 (30%), Positives = 26/49 (53%) Frame = +3 Query: 387 STNRMLNVQSLTYWPP*KYWTDIFSHAPSLLPRESHLPMSLSSVTLLHA 533 S + + +LT P K + D FS+ P +LP + HL + + ++HA Sbjct: 113 SREQSKSTTTLTSDPVLKDYLDCFSNKPGMLPNKVHLEVDSAVTPVIHA 161 >SB_46473| Best HMM Match : RVP (HMM E-Value=0.029) Length = 304 Score = 30.7 bits (66), Expect = 1.5 Identities = 15/49 (30%), Positives = 26/49 (53%) Frame = +3 Query: 387 STNRMLNVQSLTYWPP*KYWTDIFSHAPSLLPRESHLPMSLSSVTLLHA 533 S + + +LT P K + D FS+ P +LP + HL + + ++HA Sbjct: 165 SREQSKSTTTLTSDPVLKDYLDCFSNKPGMLPNKVHLEVDSAVTPVIHA 213 >SB_29974| Best HMM Match : RVT_1 (HMM E-Value=3e-17) Length = 890 Score = 30.7 bits (66), Expect = 1.5 Identities = 15/49 (30%), Positives = 26/49 (53%) Frame = +3 Query: 387 STNRMLNVQSLTYWPP*KYWTDIFSHAPSLLPRESHLPMSLSSVTLLHA 533 S + + +LT P K + D FS+ P +LP + HL + + ++HA Sbjct: 113 SREQSKSTTTLTSDPVLKDYLDCFSNKPGMLPNKVHLEVDSAVTPVIHA 161 >SB_27267| Best HMM Match : RVT_1 (HMM E-Value=5.6e-17) Length = 649 Score = 30.7 bits (66), Expect = 1.5 Identities = 15/49 (30%), Positives = 26/49 (53%) Frame = +3 Query: 387 STNRMLNVQSLTYWPP*KYWTDIFSHAPSLLPRESHLPMSLSSVTLLHA 533 S + + +LT P K + D FS+ P +LP + HL + + ++HA Sbjct: 337 SREQSKSTTTLTSDPVLKDYLDCFSNKPGMLPNKVHLEVDSAVTPVIHA 385 >SB_8937| Best HMM Match : RVP (HMM E-Value=0.029) Length = 303 Score = 30.7 bits (66), Expect = 1.5 Identities = 15/49 (30%), Positives = 26/49 (53%) Frame = +3 Query: 387 STNRMLNVQSLTYWPP*KYWTDIFSHAPSLLPRESHLPMSLSSVTLLHA 533 S + + +LT P K + D FS+ P +LP + HL + + ++HA Sbjct: 165 SREQSKSTTTLTSDPVLKDYLDCFSNKPGMLPNKVHLEVDSAVTPVIHA 213 >SB_4291| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 165 Score = 30.7 bits (66), Expect = 1.5 Identities = 15/49 (30%), Positives = 26/49 (53%) Frame = +3 Query: 387 STNRMLNVQSLTYWPP*KYWTDIFSHAPSLLPRESHLPMSLSSVTLLHA 533 S + + +LT P K + D FS+ P +LP + HL + + ++HA Sbjct: 61 SREQSKSTTTLTSDPVLKDYLDCFSNKPGMLPNKVHLEVDSAVTPVIHA 109 >SB_59190| Best HMM Match : rve (HMM E-Value=6e-18) Length = 660 Score = 30.3 bits (65), Expect = 2.0 Identities = 14/40 (35%), Positives = 23/40 (57%) Frame = +3 Query: 414 SLTYWPP*KYWTDIFSHAPSLLPRESHLPMSLSSVTLLHA 533 +LT P K + D FS+ P +LP + HL + + ++HA Sbjct: 174 TLTSDPVLKDYLDCFSNKPGMLPNKVHLEVDSAVTPVIHA 213 >SB_42289| Best HMM Match : RVT_1 (HMM E-Value=5.2e-17) Length = 429 Score = 30.3 bits (65), Expect = 2.0 Identities = 14/40 (35%), Positives = 23/40 (57%) Frame = +3 Query: 414 SLTYWPP*KYWTDIFSHAPSLLPRESHLPMSLSSVTLLHA 533 +LT P K + D FS+ P +LP + HL + + ++HA Sbjct: 28 TLTSDPVLKDYLDCFSNKPGMLPNKVHLEVDSAVTPVIHA 67 >SB_45212| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1304 Score = 29.9 bits (64), Expect = 2.7 Identities = 16/48 (33%), Positives = 23/48 (47%) Frame = +2 Query: 359 VFPYLGIMQFNKQNVERAKSDLLAALKVLDGHLLTRTFLVTERITLAD 502 ++P + Q NV+R +DL + K+ L R F V E T AD Sbjct: 73 IYPNIMDEQIRTANVQRGSADLQTSAKITLKKFLPRCFSVIESTTSAD 120 >SB_37850| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 509 Score = 29.5 bits (63), Expect = 3.6 Identities = 14/30 (46%), Positives = 16/30 (53%) Frame = -2 Query: 550 SSTCWKACSSVTEDNDIGKCDSLGNKEGAC 461 SS CWK+CS D +C L KEG C Sbjct: 463 SSQCWKSCSGCCVDKKPVQC-PLWAKEGEC 491 >SB_16159| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 351 Score = 29.1 bits (62), Expect = 4.7 Identities = 11/25 (44%), Positives = 15/25 (60%) Frame = +2 Query: 281 DLATQARVWQWASWSDSELLPASCA 355 DL T A+V+ WA W ++ SCA Sbjct: 78 DLTTTAQVYSWAMWEPWQMRNLSCA 102 >SB_25676| Best HMM Match : TSP_1 (HMM E-Value=0.0055) Length = 141 Score = 29.1 bits (62), Expect = 4.7 Identities = 11/25 (44%), Positives = 15/25 (60%) Frame = +2 Query: 281 DLATQARVWQWASWSDSELLPASCA 355 DL T A+V+ WA W ++ SCA Sbjct: 78 DLTTTAQVYSWAMWEPWQMRNLSCA 102 >SB_52428| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 94 Score = 28.7 bits (61), Expect = 6.2 Identities = 14/36 (38%), Positives = 21/36 (58%) Frame = -3 Query: 600 RSGTNAERLSATNGRSGLARAGKHAAVXLKTMTSAS 493 +SG N + SA + RS AGK A + +KT+ A+ Sbjct: 24 KSGININKYSAHSTRSASMSAGKTANISIKTIMDAT 59 >SB_36561| Best HMM Match : BACK (HMM E-Value=1.4013e-45) Length = 554 Score = 28.7 bits (61), Expect = 6.2 Identities = 25/77 (32%), Positives = 38/77 (49%), Gaps = 1/77 (1%) Frame = +2 Query: 377 IMQFNKQNVERAKSDLLAALKVLDGHLLTRTFLVTERITLADVIVFSXTAACFPARARPE 556 +M + K +VE K DL L+ + LLTR FL+ + + D+I+ RP Sbjct: 194 VMSWIKHDVESRKKDLANLLEHIRFPLLTRKFLI-DTVAKEDLIM----------NERPC 242 Query: 557 RPFVADKRS-ALVPDRR 604 R FV + L+P+RR Sbjct: 243 REFVLEAIDYHLIPERR 259 >SB_16289| Best HMM Match : Phage_integrase (HMM E-Value=0.4) Length = 158 Score = 28.7 bits (61), Expect = 6.2 Identities = 14/36 (38%), Positives = 21/36 (58%) Frame = -3 Query: 600 RSGTNAERLSATNGRSGLARAGKHAAVXLKTMTSAS 493 +SG N + SA + RS AGK A + +KT+ A+ Sbjct: 88 KSGININKYSAHSTRSASMSAGKTANISIKTIMDAA 123 >SB_51364| Best HMM Match : DUF1431 (HMM E-Value=5.9) Length = 364 Score = 28.7 bits (61), Expect = 6.2 Identities = 14/40 (35%), Positives = 22/40 (55%) Frame = -1 Query: 188 LFRQETSSRSLRTCWSRQIRNSVLLSHQSRNIVRRSTLYK 69 +FR + + + S ++ N V +SHQSR IV T+ K Sbjct: 102 VFRSKQQAPNKAVGRSDEVTNEVAVSHQSRRIVESETVRK 141 >SB_39324| Best HMM Match : S-antigen (HMM E-Value=1.2) Length = 252 Score = 28.7 bits (61), Expect = 6.2 Identities = 14/40 (35%), Positives = 23/40 (57%) Frame = -2 Query: 604 ATVRNQR*TFISDERTLGSSTCWKACSSVTEDNDIGKCDS 485 AT ++R +S E T SST + SS ++ND+ + D+ Sbjct: 14 ATTEDERLNEVSQEETTKSSTKLNSDSSAKDENDVNEGDT 53 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 26,280,178 Number of Sequences: 59808 Number of extensions: 577483 Number of successful extensions: 1781 Number of sequences better than 10.0: 28 Number of HSP's better than 10.0 without gapping: 1613 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1778 length of database: 16,821,457 effective HSP length: 81 effective length of database: 11,977,009 effective search space used: 2383424791 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -