BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= FWDP01_FL5_M09 (848 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value X02007-1|CAA26038.1| 70|Apis mellifera prepromelittin protein. 24 2.0 AF388659-3|AAK71993.1| 548|Apis mellifera 1D-myo-inositol-trisp... 24 2.0 AJ968562-1|CAI91546.1| 998|Apis mellifera protein ( Apis mellif... 22 6.2 AY739659-1|AAU85298.1| 288|Apis mellifera hyperpolarization-act... 22 8.2 AY739658-1|AAU85297.1| 664|Apis mellifera hyperpolarization-act... 22 8.2 AY395072-1|AAQ96728.1| 593|Apis mellifera GABA neurotransmitter... 22 8.2 AY395071-1|AAQ96727.1| 646|Apis mellifera GABA neurotransmitter... 22 8.2 AY280848-1|AAQ16312.1| 632|Apis mellifera hyperpolarization-act... 22 8.2 >X02007-1|CAA26038.1| 70|Apis mellifera prepromelittin protein. Length = 70 Score = 23.8 bits (49), Expect = 2.0 Identities = 9/38 (23%), Positives = 17/38 (44%) Frame = -2 Query: 133 PTSDLRPGSEPGQSRGVPAVNTITRLGVPGIPCWVKNQ 20 P + +E G+ AV + G+P + W+K + Sbjct: 29 PEPEAEADAEADPEAGIGAVLKVLTTGLPALISWIKRK 66 >AF388659-3|AAK71993.1| 548|Apis mellifera 1D-myo-inositol-trisphosphate 3-kinaseisoform C protein. Length = 548 Score = 23.8 bits (49), Expect = 2.0 Identities = 17/57 (29%), Positives = 25/57 (43%) Frame = +3 Query: 624 CPRTTCV*WKRVNSLTFRFXWLFISAIGCMRSPXVXRXVTXSITTEFXSXXHXEXKS 794 C R + K + S + R+ F S+I RSP R + S+ T H + KS Sbjct: 6 CDRKSLSQRKIIRSRSRRYSKRFSSSIVDRRSPSSSRSPSPSLLTSQPHQDHNKEKS 62 >AJ968562-1|CAI91546.1| 998|Apis mellifera protein ( Apis mellifera ORF for hypotheticalprotein. ). Length = 998 Score = 22.2 bits (45), Expect = 6.2 Identities = 10/23 (43%), Positives = 15/23 (65%) Frame = +3 Query: 393 KQNANNFNSEFKINHXTVSNGVI 461 +Q+ N+F + INH V+ GVI Sbjct: 886 EQSFNHFVLKMGINHGPVTAGVI 908 >AY739659-1|AAU85298.1| 288|Apis mellifera hyperpolarization-activated ion channelvariant T protein. Length = 288 Score = 21.8 bits (44), Expect = 8.2 Identities = 9/29 (31%), Positives = 17/29 (58%) Frame = -1 Query: 428 FKFTIEIVCILFFIVGELLSMVIMFFFFN 342 F+F ++ C+L +V L+ + + FFN Sbjct: 87 FRFYWDL-CMLLLLVANLIILPVAISFFN 114 >AY739658-1|AAU85297.1| 664|Apis mellifera hyperpolarization-activated ion channelvariant L protein. Length = 664 Score = 21.8 bits (44), Expect = 8.2 Identities = 9/29 (31%), Positives = 17/29 (58%) Frame = -1 Query: 428 FKFTIEIVCILFFIVGELLSMVIMFFFFN 342 F+F ++ C+L +V L+ + + FFN Sbjct: 87 FRFYWDL-CMLLLLVANLIILPVAISFFN 114 >AY395072-1|AAQ96728.1| 593|Apis mellifera GABA neurotransmitter transporter-1B protein. Length = 593 Score = 21.8 bits (44), Expect = 8.2 Identities = 11/21 (52%), Positives = 11/21 (52%) Frame = +2 Query: 152 SHFSAVGP*KEPWARNRLQIS 214 SH P KE W R LQIS Sbjct: 176 SHALLKDPVKEFWERRTLQIS 196 >AY395071-1|AAQ96727.1| 646|Apis mellifera GABA neurotransmitter transporter-1B protein. Length = 646 Score = 21.8 bits (44), Expect = 8.2 Identities = 11/21 (52%), Positives = 11/21 (52%) Frame = +2 Query: 152 SHFSAVGP*KEPWARNRLQIS 214 SH P KE W R LQIS Sbjct: 229 SHALLKDPVKEFWERRTLQIS 249 >AY280848-1|AAQ16312.1| 632|Apis mellifera hyperpolarization-activated ion channel protein. Length = 632 Score = 21.8 bits (44), Expect = 8.2 Identities = 9/29 (31%), Positives = 17/29 (58%) Frame = -1 Query: 428 FKFTIEIVCILFFIVGELLSMVIMFFFFN 342 F+F ++ C+L +V L+ + + FFN Sbjct: 87 FRFYWDL-CMLLLLVANLIILPVAISFFN 114 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 197,833 Number of Sequences: 438 Number of extensions: 3922 Number of successful extensions: 12 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 11 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 12 length of database: 146,343 effective HSP length: 57 effective length of database: 121,377 effective search space used: 27309825 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -