BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= FWDP01_FL5_M07 (837 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AF498306-5|AAM19330.1| 456|Apis mellifera dopamine receptor typ... 27 0.28 AJ780964-1|CAG62942.2| 332|Apis mellifera putative corticotropi... 24 1.5 DQ013068-1|AAY81956.1| 931|Apis mellifera dusty protein kinase ... 22 6.1 DQ013067-1|AAY81955.1| 969|Apis mellifera dusty protein kinase ... 22 6.1 >AF498306-5|AAM19330.1| 456|Apis mellifera dopamine receptor type D2 protein. Length = 456 Score = 26.6 bits (56), Expect = 0.28 Identities = 15/51 (29%), Positives = 26/51 (50%) Frame = -3 Query: 613 WFSAMSLEDNNSYTNFLFNVAIKKSTTVSIAFPSPIATAPSNSSVLLFIVR 461 ++SA N S L+N+A ++ + F +AT N+ V+L +VR Sbjct: 22 FYSASYPPQNRSQEEDLWNLATDRAGLAILLFLFSVATVFGNTLVILAVVR 72 >AJ780964-1|CAG62942.2| 332|Apis mellifera putative corticotropin releasing hormone-binding protein protein. Length = 332 Score = 24.2 bits (50), Expect = 1.5 Identities = 12/47 (25%), Positives = 22/47 (46%) Frame = -1 Query: 399 LEILDSVLGLDLXPDCAKRIKSKTLGVTKLINGI*ATFTVLILLELK 259 + I+DS+ G+D PD + + V + +G F + + LK Sbjct: 276 VHIIDSICGIDSKPDYRELTEYSVTSVRLISSGFFDNFVTVQIQPLK 322 >DQ013068-1|AAY81956.1| 931|Apis mellifera dusty protein kinase isoform B protein. Length = 931 Score = 22.2 bits (45), Expect = 6.1 Identities = 7/13 (53%), Positives = 10/13 (76%) Frame = -2 Query: 410 CHGLWRFLTLFLG 372 C+GLWR++ L G Sbjct: 55 CNGLWRWIRLTYG 67 >DQ013067-1|AAY81955.1| 969|Apis mellifera dusty protein kinase isoform A protein. Length = 969 Score = 22.2 bits (45), Expect = 6.1 Identities = 7/13 (53%), Positives = 10/13 (76%) Frame = -2 Query: 410 CHGLWRFLTLFLG 372 C+GLWR++ L G Sbjct: 93 CNGLWRWIRLTYG 105 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 185,924 Number of Sequences: 438 Number of extensions: 3577 Number of successful extensions: 5 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5 length of database: 146,343 effective HSP length: 57 effective length of database: 121,377 effective search space used: 26824317 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -