BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= FWDP01_FL5_M06 (855 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AY043292-1|AAK96031.1| 323|Tribolium castaneum homeodomain tran... 25 0.76 AM292362-1|CAL23174.2| 398|Tribolium castaneum gustatory recept... 24 1.8 AM712901-1|CAN84640.1| 205|Tribolium castaneum hypothetical pro... 23 4.1 AM292367-1|CAL23179.2| 1451|Tribolium castaneum gustatory recept... 22 5.4 >AY043292-1|AAK96031.1| 323|Tribolium castaneum homeodomain transcription factor Prothoraxlessprotein. Length = 323 Score = 25.0 bits (52), Expect = 0.76 Identities = 10/27 (37%), Positives = 13/27 (48%) Frame = +1 Query: 703 PSLTAEARVTNHHYSTPXRGSKPYVGM 783 PS+ + HHY P G +P GM Sbjct: 52 PSVGLRQGIPPHHYGGPPSGGQPPQGM 78 >AM292362-1|CAL23174.2| 398|Tribolium castaneum gustatory receptor candidate 41 protein. Length = 398 Score = 23.8 bits (49), Expect = 1.8 Identities = 7/17 (41%), Positives = 10/17 (58%) Frame = +2 Query: 35 WRSAKSYENFKTFISDV 85 W +SY NF F+ D+ Sbjct: 64 WNQFRSYSNFSVFLFDI 80 >AM712901-1|CAN84640.1| 205|Tribolium castaneum hypothetical protein protein. Length = 205 Score = 22.6 bits (46), Expect = 4.1 Identities = 7/17 (41%), Positives = 12/17 (70%) Frame = -3 Query: 100 NLIHLYVTDKCFKIFIR 50 NL+++Y D F +F+R Sbjct: 156 NLVYVYCCDNNFNVFLR 172 >AM292367-1|CAL23179.2| 1451|Tribolium castaneum gustatory receptor candidate 46 protein. Length = 1451 Score = 22.2 bits (45), Expect = 5.4 Identities = 15/57 (26%), Positives = 24/57 (42%), Gaps = 4/57 (7%) Frame = +3 Query: 519 CLVNELLQTEGLQCQQLYLKLILIQCRV*VICHGSTLAITTI----QFLVKVVTHQH 677 C+V +L + + LQ L L V ICH I + + + K+ T+ H Sbjct: 895 CVVLQLQENDWLQLGYLIFVSTLYTANVVCICHVCYSTIQEVSKSGELIHKIATNDH 951 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 189,054 Number of Sequences: 336 Number of extensions: 3832 Number of successful extensions: 10 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 10 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 10 length of database: 122,585 effective HSP length: 56 effective length of database: 103,769 effective search space used: 23659332 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -