BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= FWDP01_FL5_M03 (865 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY056833-1|AAL23627.1| 1253|Anopheles gambiae chitin synthase pr... 24 5.2 AM422833-1|CAM12801.1| 2139|Anopheles gambiae voltage-gated sodi... 24 6.9 >AY056833-1|AAL23627.1| 1253|Anopheles gambiae chitin synthase protein. Length = 1253 Score = 24.2 bits (50), Expect = 5.2 Identities = 13/39 (33%), Positives = 20/39 (51%) Frame = -3 Query: 623 SWAVANXLDV*GYFLLDFLKSGLTVWWFSGIHFVYSYDE 507 ++ +AN L V FLL K L + W+ + S+DE Sbjct: 927 AFVMANALFVLVIFLLQLKKQELHIEWWFNVKNKISFDE 965 >AM422833-1|CAM12801.1| 2139|Anopheles gambiae voltage-gated sodium channel alpha subunitprotein. Length = 2139 Score = 23.8 bits (49), Expect = 6.9 Identities = 12/42 (28%), Positives = 24/42 (57%), Gaps = 4/42 (9%) Frame = +1 Query: 523 TKWIPLNHHTVSPDLRKSRRK----YPHTSRXLATAQLLSLS 636 T ++ L+HH + PD+ K+ + + T AT +L+++S Sbjct: 822 TLFMALDHHDMDPDMEKALKSGNYFFTATFAIEATMKLIAMS 863 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 886,256 Number of Sequences: 2352 Number of extensions: 18842 Number of successful extensions: 27 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 25 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 27 length of database: 563,979 effective HSP length: 64 effective length of database: 413,451 effective search space used: 92199573 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -