BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= FWDP01_FL5_M02 (819 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY753540-1|AAV28543.1| 3320|Anopheles gambiae SGS3 protein. 25 2.1 AY753539-1|AAV28542.1| 3318|Anopheles gambiae SGS2 protein. 25 2.1 AY263176-1|AAP78791.1| 705|Anopheles gambiae TmcB-like protein ... 25 2.8 EF519384-1|ABP68493.1| 506|Anopheles gambiae LRIM1 protein. 25 3.7 EF519383-1|ABP68492.1| 506|Anopheles gambiae LRIM1 protein. 25 3.7 EF519382-1|ABP68491.1| 493|Anopheles gambiae LRIM1 protein. 25 3.7 EF519381-1|ABP68490.1| 506|Anopheles gambiae LRIM1 protein. 25 3.7 EF519380-1|ABP68489.1| 506|Anopheles gambiae LRIM1 protein. 25 3.7 EF519376-1|ABP68485.1| 506|Anopheles gambiae LRIM1 protein. 25 3.7 EF519375-1|ABP68484.1| 493|Anopheles gambiae LRIM1 protein. 25 3.7 EF519373-1|ABP68482.1| 506|Anopheles gambiae LRIM1 protein. 25 3.7 EF519372-1|ABP68481.1| 506|Anopheles gambiae LRIM1 protein. 25 3.7 EF519371-1|ABP68480.1| 506|Anopheles gambiae LRIM1 protein. 25 3.7 EF519370-1|ABP68479.1| 452|Anopheles gambiae LRIM1 protein. 25 3.7 EF519369-1|ABP68478.1| 506|Anopheles gambiae LRIM1 protein. 25 3.7 EF519368-1|ABP68477.1| 506|Anopheles gambiae LRIM1 protein. 25 3.7 EF519367-1|ABP68476.1| 506|Anopheles gambiae LRIM1 protein. 25 3.7 EF519366-1|ABP68475.1| 506|Anopheles gambiae LRIM1 protein. 25 3.7 EF519364-1|ABP68473.1| 496|Anopheles gambiae LRIM1 protein. 25 3.7 EF519362-1|ABP68471.1| 506|Anopheles gambiae LRIM1 protein. 25 3.7 EF519361-1|ABP68470.1| 497|Anopheles gambiae LRIM1 protein. 25 3.7 EF519360-1|ABP68469.1| 499|Anopheles gambiae LRIM1 protein. 25 3.7 EF519359-1|ABP68468.1| 506|Anopheles gambiae LRIM1 protein. 25 3.7 EF519358-1|ABP68467.1| 497|Anopheles gambiae LRIM1 protein. 25 3.7 EF519357-1|ABP68466.1| 506|Anopheles gambiae LRIM1 protein. 25 3.7 EF519356-1|ABP68465.1| 500|Anopheles gambiae LRIM1 protein. 25 3.7 EF519355-1|ABP68464.1| 506|Anopheles gambiae LRIM1 protein. 25 3.7 EF519351-1|ABP68460.1| 486|Anopheles gambiae LRIM1 protein. 25 3.7 EF519350-1|ABP68459.1| 421|Anopheles gambiae LRIM1 protein. 25 3.7 EF519347-1|ABP68456.1| 470|Anopheles gambiae LRIM1 protein. 25 3.7 AY344814-1|AAR03842.1| 286|Anopheles gambiae LRR Toll protein. 25 3.7 AY344811-1|AAR03839.1| 286|Anopheles gambiae LRR Toll protein. 25 3.7 AY344810-1|AAR03838.1| 286|Anopheles gambiae LRR Toll protein. 25 3.7 AY344809-1|AAR03837.1| 286|Anopheles gambiae LRR Toll protein. 25 3.7 EF519374-1|ABP68483.1| 506|Anopheles gambiae LRIM1 protein. 24 4.9 EF519363-1|ABP68472.1| 503|Anopheles gambiae LRIM1 protein. 24 4.9 EF519354-1|ABP68463.1| 506|Anopheles gambiae LRIM1 protein. 24 4.9 EF519353-1|ABP68462.1| 470|Anopheles gambiae LRIM1 protein. 24 4.9 AY705403-1|AAU12512.1| 520|Anopheles gambiae nicotinic acetylch... 24 4.9 AY344813-1|AAR03841.1| 286|Anopheles gambiae LRR Toll protein. 24 4.9 AY344812-1|AAR03840.1| 286|Anopheles gambiae LRR Toll protein. 24 4.9 EF519365-1|ABP68474.1| 486|Anopheles gambiae LRIM1 protein. 24 6.5 EF519352-1|ABP68461.1| 448|Anopheles gambiae LRIM1 protein. 24 6.5 EF519349-1|ABP68458.1| 486|Anopheles gambiae LRIM1 protein. 24 6.5 EF519348-1|ABP68457.1| 503|Anopheles gambiae LRIM1 protein. 24 6.5 AY578798-1|AAT07303.1| 356|Anopheles gambiae baboon protein. 23 8.6 >AY753540-1|AAV28543.1| 3320|Anopheles gambiae SGS3 protein. Length = 3320 Score = 25.4 bits (53), Expect = 2.1 Identities = 9/20 (45%), Positives = 13/20 (65%) Frame = -2 Query: 236 PLVDDEGVSSSKEESNKAPA 177 PL++ EG+ KE N AP+ Sbjct: 2540 PLIEYEGIYEGKESENNAPS 2559 >AY753539-1|AAV28542.1| 3318|Anopheles gambiae SGS2 protein. Length = 3318 Score = 25.4 bits (53), Expect = 2.1 Identities = 9/20 (45%), Positives = 13/20 (65%) Frame = -2 Query: 236 PLVDDEGVSSSKEESNKAPA 177 PL++ EG+ KE N AP+ Sbjct: 2541 PLIEYEGIYEGKESENNAPS 2560 >AY263176-1|AAP78791.1| 705|Anopheles gambiae TmcB-like protein protein. Length = 705 Score = 25.0 bits (52), Expect = 2.8 Identities = 10/29 (34%), Positives = 15/29 (51%) Frame = +3 Query: 609 REGPMIPRPKPPLGLLSTDDFPLIYKKTM 695 R GP+ P PP + T L+Y +T+ Sbjct: 443 RAGPLAPYLTPPPFCIETHSLGLVYNQTL 471 >EF519384-1|ABP68493.1| 506|Anopheles gambiae LRIM1 protein. Length = 506 Score = 24.6 bits (51), Expect = 3.7 Identities = 9/14 (64%), Positives = 12/14 (85%) Frame = -3 Query: 625 IIGPSRHTLHAANH 584 ++GPS TLHAAN+ Sbjct: 118 LVGPSIETLHAANN 131 >EF519383-1|ABP68492.1| 506|Anopheles gambiae LRIM1 protein. Length = 506 Score = 24.6 bits (51), Expect = 3.7 Identities = 9/14 (64%), Positives = 12/14 (85%) Frame = -3 Query: 625 IIGPSRHTLHAANH 584 ++GPS TLHAAN+ Sbjct: 118 LVGPSIETLHAANN 131 >EF519382-1|ABP68491.1| 493|Anopheles gambiae LRIM1 protein. Length = 493 Score = 24.6 bits (51), Expect = 3.7 Identities = 9/14 (64%), Positives = 12/14 (85%) Frame = -3 Query: 625 IIGPSRHTLHAANH 584 ++GPS TLHAAN+ Sbjct: 118 LVGPSIETLHAANN 131 >EF519381-1|ABP68490.1| 506|Anopheles gambiae LRIM1 protein. Length = 506 Score = 24.6 bits (51), Expect = 3.7 Identities = 9/14 (64%), Positives = 12/14 (85%) Frame = -3 Query: 625 IIGPSRHTLHAANH 584 ++GPS TLHAAN+ Sbjct: 118 LVGPSIETLHAANN 131 >EF519380-1|ABP68489.1| 506|Anopheles gambiae LRIM1 protein. Length = 506 Score = 24.6 bits (51), Expect = 3.7 Identities = 9/14 (64%), Positives = 12/14 (85%) Frame = -3 Query: 625 IIGPSRHTLHAANH 584 ++GPS TLHAAN+ Sbjct: 118 LVGPSIETLHAANN 131 >EF519376-1|ABP68485.1| 506|Anopheles gambiae LRIM1 protein. Length = 506 Score = 24.6 bits (51), Expect = 3.7 Identities = 9/14 (64%), Positives = 12/14 (85%) Frame = -3 Query: 625 IIGPSRHTLHAANH 584 ++GPS TLHAAN+ Sbjct: 118 LVGPSIETLHAANN 131 >EF519375-1|ABP68484.1| 493|Anopheles gambiae LRIM1 protein. Length = 493 Score = 24.6 bits (51), Expect = 3.7 Identities = 9/14 (64%), Positives = 12/14 (85%) Frame = -3 Query: 625 IIGPSRHTLHAANH 584 ++GPS TLHAAN+ Sbjct: 118 LVGPSIETLHAANN 131 >EF519373-1|ABP68482.1| 506|Anopheles gambiae LRIM1 protein. Length = 506 Score = 24.6 bits (51), Expect = 3.7 Identities = 9/14 (64%), Positives = 12/14 (85%) Frame = -3 Query: 625 IIGPSRHTLHAANH 584 ++GPS TLHAAN+ Sbjct: 118 LVGPSIETLHAANN 131 >EF519372-1|ABP68481.1| 506|Anopheles gambiae LRIM1 protein. Length = 506 Score = 24.6 bits (51), Expect = 3.7 Identities = 9/14 (64%), Positives = 12/14 (85%) Frame = -3 Query: 625 IIGPSRHTLHAANH 584 ++GPS TLHAAN+ Sbjct: 118 LVGPSIETLHAANN 131 >EF519371-1|ABP68480.1| 506|Anopheles gambiae LRIM1 protein. Length = 506 Score = 24.6 bits (51), Expect = 3.7 Identities = 9/14 (64%), Positives = 12/14 (85%) Frame = -3 Query: 625 IIGPSRHTLHAANH 584 ++GPS TLHAAN+ Sbjct: 118 LVGPSIETLHAANN 131 >EF519370-1|ABP68479.1| 452|Anopheles gambiae LRIM1 protein. Length = 452 Score = 24.6 bits (51), Expect = 3.7 Identities = 9/14 (64%), Positives = 12/14 (85%) Frame = -3 Query: 625 IIGPSRHTLHAANH 584 ++GPS TLHAAN+ Sbjct: 103 LVGPSIETLHAANN 116 >EF519369-1|ABP68478.1| 506|Anopheles gambiae LRIM1 protein. Length = 506 Score = 24.6 bits (51), Expect = 3.7 Identities = 9/14 (64%), Positives = 12/14 (85%) Frame = -3 Query: 625 IIGPSRHTLHAANH 584 ++GPS TLHAAN+ Sbjct: 118 LVGPSIETLHAANN 131 >EF519368-1|ABP68477.1| 506|Anopheles gambiae LRIM1 protein. Length = 506 Score = 24.6 bits (51), Expect = 3.7 Identities = 9/14 (64%), Positives = 12/14 (85%) Frame = -3 Query: 625 IIGPSRHTLHAANH 584 ++GPS TLHAAN+ Sbjct: 118 LVGPSIETLHAANN 131 >EF519367-1|ABP68476.1| 506|Anopheles gambiae LRIM1 protein. Length = 506 Score = 24.6 bits (51), Expect = 3.7 Identities = 9/14 (64%), Positives = 12/14 (85%) Frame = -3 Query: 625 IIGPSRHTLHAANH 584 ++GPS TLHAAN+ Sbjct: 118 LVGPSIETLHAANN 131 >EF519366-1|ABP68475.1| 506|Anopheles gambiae LRIM1 protein. Length = 506 Score = 24.6 bits (51), Expect = 3.7 Identities = 9/14 (64%), Positives = 12/14 (85%) Frame = -3 Query: 625 IIGPSRHTLHAANH 584 ++GPS TLHAAN+ Sbjct: 118 LVGPSIETLHAANN 131 >EF519364-1|ABP68473.1| 496|Anopheles gambiae LRIM1 protein. Length = 496 Score = 24.6 bits (51), Expect = 3.7 Identities = 9/14 (64%), Positives = 12/14 (85%) Frame = -3 Query: 625 IIGPSRHTLHAANH 584 ++GPS TLHAAN+ Sbjct: 118 LVGPSIETLHAANN 131 >EF519362-1|ABP68471.1| 506|Anopheles gambiae LRIM1 protein. Length = 506 Score = 24.6 bits (51), Expect = 3.7 Identities = 9/14 (64%), Positives = 12/14 (85%) Frame = -3 Query: 625 IIGPSRHTLHAANH 584 ++GPS TLHAAN+ Sbjct: 118 LVGPSIETLHAANN 131 >EF519361-1|ABP68470.1| 497|Anopheles gambiae LRIM1 protein. Length = 497 Score = 24.6 bits (51), Expect = 3.7 Identities = 9/14 (64%), Positives = 12/14 (85%) Frame = -3 Query: 625 IIGPSRHTLHAANH 584 ++GPS TLHAAN+ Sbjct: 118 LVGPSIETLHAANN 131 >EF519360-1|ABP68469.1| 499|Anopheles gambiae LRIM1 protein. Length = 499 Score = 24.6 bits (51), Expect = 3.7 Identities = 9/14 (64%), Positives = 12/14 (85%) Frame = -3 Query: 625 IIGPSRHTLHAANH 584 ++GPS TLHAAN+ Sbjct: 118 LVGPSIETLHAANN 131 >EF519359-1|ABP68468.1| 506|Anopheles gambiae LRIM1 protein. Length = 506 Score = 24.6 bits (51), Expect = 3.7 Identities = 9/14 (64%), Positives = 12/14 (85%) Frame = -3 Query: 625 IIGPSRHTLHAANH 584 ++GPS TLHAAN+ Sbjct: 118 LVGPSIETLHAANN 131 >EF519358-1|ABP68467.1| 497|Anopheles gambiae LRIM1 protein. Length = 497 Score = 24.6 bits (51), Expect = 3.7 Identities = 9/14 (64%), Positives = 12/14 (85%) Frame = -3 Query: 625 IIGPSRHTLHAANH 584 ++GPS TLHAAN+ Sbjct: 118 LVGPSIETLHAANN 131 >EF519357-1|ABP68466.1| 506|Anopheles gambiae LRIM1 protein. Length = 506 Score = 24.6 bits (51), Expect = 3.7 Identities = 9/14 (64%), Positives = 12/14 (85%) Frame = -3 Query: 625 IIGPSRHTLHAANH 584 ++GPS TLHAAN+ Sbjct: 118 LVGPSIETLHAANN 131 >EF519356-1|ABP68465.1| 500|Anopheles gambiae LRIM1 protein. Length = 500 Score = 24.6 bits (51), Expect = 3.7 Identities = 9/14 (64%), Positives = 12/14 (85%) Frame = -3 Query: 625 IIGPSRHTLHAANH 584 ++GPS TLHAAN+ Sbjct: 118 LVGPSIETLHAANN 131 >EF519355-1|ABP68464.1| 506|Anopheles gambiae LRIM1 protein. Length = 506 Score = 24.6 bits (51), Expect = 3.7 Identities = 9/14 (64%), Positives = 12/14 (85%) Frame = -3 Query: 625 IIGPSRHTLHAANH 584 ++GPS TLHAAN+ Sbjct: 118 LVGPSIETLHAANN 131 >EF519351-1|ABP68460.1| 486|Anopheles gambiae LRIM1 protein. Length = 486 Score = 24.6 bits (51), Expect = 3.7 Identities = 9/14 (64%), Positives = 12/14 (85%) Frame = -3 Query: 625 IIGPSRHTLHAANH 584 ++GPS TLHAAN+ Sbjct: 118 LVGPSIETLHAANN 131 >EF519350-1|ABP68459.1| 421|Anopheles gambiae LRIM1 protein. Length = 421 Score = 24.6 bits (51), Expect = 3.7 Identities = 9/14 (64%), Positives = 12/14 (85%) Frame = -3 Query: 625 IIGPSRHTLHAANH 584 ++GPS TLHAAN+ Sbjct: 118 LVGPSIETLHAANN 131 >EF519347-1|ABP68456.1| 470|Anopheles gambiae LRIM1 protein. Length = 470 Score = 24.6 bits (51), Expect = 3.7 Identities = 9/14 (64%), Positives = 12/14 (85%) Frame = -3 Query: 625 IIGPSRHTLHAANH 584 ++GPS TLHAAN+ Sbjct: 118 LVGPSIETLHAANN 131 >AY344814-1|AAR03842.1| 286|Anopheles gambiae LRR Toll protein. Length = 286 Score = 24.6 bits (51), Expect = 3.7 Identities = 9/14 (64%), Positives = 12/14 (85%) Frame = -3 Query: 625 IIGPSRHTLHAANH 584 ++GPS TLHAAN+ Sbjct: 43 LVGPSIETLHAANN 56 >AY344811-1|AAR03839.1| 286|Anopheles gambiae LRR Toll protein. Length = 286 Score = 24.6 bits (51), Expect = 3.7 Identities = 9/14 (64%), Positives = 12/14 (85%) Frame = -3 Query: 625 IIGPSRHTLHAANH 584 ++GPS TLHAAN+ Sbjct: 43 LVGPSIETLHAANN 56 >AY344810-1|AAR03838.1| 286|Anopheles gambiae LRR Toll protein. Length = 286 Score = 24.6 bits (51), Expect = 3.7 Identities = 9/14 (64%), Positives = 12/14 (85%) Frame = -3 Query: 625 IIGPSRHTLHAANH 584 ++GPS TLHAAN+ Sbjct: 43 LVGPSIETLHAANN 56 >AY344809-1|AAR03837.1| 286|Anopheles gambiae LRR Toll protein. Length = 286 Score = 24.6 bits (51), Expect = 3.7 Identities = 9/14 (64%), Positives = 12/14 (85%) Frame = -3 Query: 625 IIGPSRHTLHAANH 584 ++GPS TLHAAN+ Sbjct: 43 LVGPSIETLHAANN 56 >EF519374-1|ABP68483.1| 506|Anopheles gambiae LRIM1 protein. Length = 506 Score = 24.2 bits (50), Expect = 4.9 Identities = 9/14 (64%), Positives = 12/14 (85%) Frame = -3 Query: 625 IIGPSRHTLHAANH 584 ++GPS TLHAAN+ Sbjct: 118 MVGPSIETLHAANN 131 >EF519363-1|ABP68472.1| 503|Anopheles gambiae LRIM1 protein. Length = 503 Score = 24.2 bits (50), Expect = 4.9 Identities = 9/14 (64%), Positives = 12/14 (85%) Frame = -3 Query: 625 IIGPSRHTLHAANH 584 ++GPS TLHAAN+ Sbjct: 118 MVGPSIETLHAANN 131 >EF519354-1|ABP68463.1| 506|Anopheles gambiae LRIM1 protein. Length = 506 Score = 24.2 bits (50), Expect = 4.9 Identities = 9/14 (64%), Positives = 12/14 (85%) Frame = -3 Query: 625 IIGPSRHTLHAANH 584 ++GPS TLHAAN+ Sbjct: 118 MVGPSIETLHAANN 131 >EF519353-1|ABP68462.1| 470|Anopheles gambiae LRIM1 protein. Length = 470 Score = 24.2 bits (50), Expect = 4.9 Identities = 9/14 (64%), Positives = 12/14 (85%) Frame = -3 Query: 625 IIGPSRHTLHAANH 584 ++GPS TLHAAN+ Sbjct: 118 MVGPSIETLHAANN 131 >AY705403-1|AAU12512.1| 520|Anopheles gambiae nicotinic acetylcholine receptor subunitalpha 8 protein. Length = 520 Score = 24.2 bits (50), Expect = 4.9 Identities = 11/34 (32%), Positives = 17/34 (50%) Frame = -3 Query: 751 IIEAWLFSNMAS*FSPFISMVFL*IKGKSSVLRR 650 ++ W S SPF+ +FL I K ++RR Sbjct: 329 VLNVWYRSTSTHKMSPFVRRLFLEIMPKILMMRR 362 >AY344813-1|AAR03841.1| 286|Anopheles gambiae LRR Toll protein. Length = 286 Score = 24.2 bits (50), Expect = 4.9 Identities = 9/14 (64%), Positives = 12/14 (85%) Frame = -3 Query: 625 IIGPSRHTLHAANH 584 ++GPS TLHAAN+ Sbjct: 43 MVGPSIETLHAANN 56 >AY344812-1|AAR03840.1| 286|Anopheles gambiae LRR Toll protein. Length = 286 Score = 24.2 bits (50), Expect = 4.9 Identities = 9/14 (64%), Positives = 12/14 (85%) Frame = -3 Query: 625 IIGPSRHTLHAANH 584 ++GPS TLHAAN+ Sbjct: 43 MVGPSIETLHAANN 56 >EF519365-1|ABP68474.1| 486|Anopheles gambiae LRIM1 protein. Length = 486 Score = 23.8 bits (49), Expect = 6.5 Identities = 9/13 (69%), Positives = 11/13 (84%) Frame = -3 Query: 622 IGPSRHTLHAANH 584 +GPS TLHAAN+ Sbjct: 119 VGPSIETLHAANN 131 >EF519352-1|ABP68461.1| 448|Anopheles gambiae LRIM1 protein. Length = 448 Score = 23.8 bits (49), Expect = 6.5 Identities = 9/13 (69%), Positives = 11/13 (84%) Frame = -3 Query: 622 IGPSRHTLHAANH 584 +GPS TLHAAN+ Sbjct: 119 VGPSIETLHAANN 131 >EF519349-1|ABP68458.1| 486|Anopheles gambiae LRIM1 protein. Length = 486 Score = 23.8 bits (49), Expect = 6.5 Identities = 9/13 (69%), Positives = 11/13 (84%) Frame = -3 Query: 622 IGPSRHTLHAANH 584 +GPS TLHAAN+ Sbjct: 119 VGPSIETLHAANN 131 >EF519348-1|ABP68457.1| 503|Anopheles gambiae LRIM1 protein. Length = 503 Score = 23.8 bits (49), Expect = 6.5 Identities = 9/13 (69%), Positives = 11/13 (84%) Frame = -3 Query: 622 IGPSRHTLHAANH 584 +GPS TLHAAN+ Sbjct: 119 VGPSIETLHAANN 131 >AY578798-1|AAT07303.1| 356|Anopheles gambiae baboon protein. Length = 356 Score = 23.4 bits (48), Expect = 8.6 Identities = 10/25 (40%), Positives = 15/25 (60%) Frame = -3 Query: 796 HVAMPRCSERXECSWIIEAWLFSNM 722 +VA+ S R ECSW EA ++ + Sbjct: 82 NVAVKIFSSREECSWSREAEIYQTI 106 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 788,635 Number of Sequences: 2352 Number of extensions: 14339 Number of successful extensions: 65 Number of sequences better than 10.0: 46 Number of HSP's better than 10.0 without gapping: 63 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 65 length of database: 563,979 effective HSP length: 63 effective length of database: 415,803 effective search space used: 86902827 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -