BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= FWDP01_FL5_M02 (819 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AB231585-1|BAE17127.1| 898|Apis mellifera Mahya protein. 26 0.48 AJ517411-1|CAD56944.1| 1770|Apis mellifera vitellogenin precurso... 25 0.84 DQ244074-1|ABB36784.1| 517|Apis mellifera cytochrome P450 monoo... 24 1.9 AB269871-1|BAF03050.1| 1923|Apis mellifera cell adhesion molecul... 24 1.9 AB257298-1|BAE93381.1| 1919|Apis mellifera Dscam family member A... 24 1.9 >AB231585-1|BAE17127.1| 898|Apis mellifera Mahya protein. Length = 898 Score = 25.8 bits (54), Expect = 0.48 Identities = 9/16 (56%), Positives = 13/16 (81%) Frame = +2 Query: 560 EVIPDTDKMVCGMKGV 607 +VIP T + VCG+KG+ Sbjct: 532 DVIPGTQEHVCGVKGI 547 >AJ517411-1|CAD56944.1| 1770|Apis mellifera vitellogenin precursor protein. Length = 1770 Score = 25.0 bits (52), Expect = 0.84 Identities = 16/55 (29%), Positives = 26/55 (47%), Gaps = 2/55 (3%) Frame = +1 Query: 202 LLEDTPSSSTNGTETLVPEDNLYALMPPFE-TF-LNVDKTARLRHFFDNVKTGEL 360 +L P S GT ++P+DN +P E F LNV+ ++ + T +L Sbjct: 1047 ILNLRPLSMEKGTRPMIPDDNTSLALPKNEGPFRLNVETAKTNEEMWELIDTEKL 1101 >DQ244074-1|ABB36784.1| 517|Apis mellifera cytochrome P450 monooxygenase protein. Length = 517 Score = 23.8 bits (49), Expect = 1.9 Identities = 11/35 (31%), Positives = 18/35 (51%) Frame = +1 Query: 226 STNGTETLVPEDNLYALMPPFETFLNVDKTARLRH 330 S ET++ ++ Y L PP E + +T R R+ Sbjct: 109 SRQDIETIIRRNSRYPLRPPQEVISHYRRTRRDRY 143 >AB269871-1|BAF03050.1| 1923|Apis mellifera cell adhesion molecule AbsCAM-Ig7B protein. Length = 1923 Score = 23.8 bits (49), Expect = 1.9 Identities = 9/36 (25%), Positives = 19/36 (52%) Frame = +3 Query: 675 LIYKKTMDMKGENYEAILEKSQASIIQLHSXLSEHL 782 +++KK K YE + E++ I+ + L +H+ Sbjct: 741 IVWKKATGSKSGEYEELRERAYTKILSNGTLLLQHV 776 >AB257298-1|BAE93381.1| 1919|Apis mellifera Dscam family member AbsCAM-Ig7A protein. Length = 1919 Score = 23.8 bits (49), Expect = 1.9 Identities = 9/36 (25%), Positives = 19/36 (52%) Frame = +3 Query: 675 LIYKKTMDMKGENYEAILEKSQASIIQLHSXLSEHL 782 +++KK K YE + E++ I+ + L +H+ Sbjct: 737 IVWKKATGSKSGEYEELRERAYTKILSNGTLLLQHV 772 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 206,966 Number of Sequences: 438 Number of extensions: 4085 Number of successful extensions: 17 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 17 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 17 length of database: 146,343 effective HSP length: 57 effective length of database: 121,377 effective search space used: 26096055 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -