BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= FWDP01_FL5_L16 (842 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value DQ490059-1|ABF22614.1| 947|Tribolium castaneum short gastrulati... 24 1.7 AF254755-1|AAF70496.1| 505|Tribolium castaneum cytochrome P450 ... 22 5.3 AY337337-1|AAP94192.1| 505|Tribolium castaneum cytochrome P450 ... 22 7.0 >DQ490059-1|ABF22614.1| 947|Tribolium castaneum short gastrulation protein. Length = 947 Score = 23.8 bits (49), Expect = 1.7 Identities = 10/40 (25%), Positives = 21/40 (52%) Frame = +2 Query: 203 VFVLGILLGQVQNKNINLENRHETENHALKCPFSRLIEDI 322 +F + + L +NK L++ T N A +C F + + ++ Sbjct: 6 LFCVLVTLATARNKAPLLDDGTRTRNKAAECVFGKQVREL 45 >AF254755-1|AAF70496.1| 505|Tribolium castaneum cytochrome P450 monooxigenase CYP4Q7 protein. Length = 505 Score = 22.2 bits (45), Expect = 5.3 Identities = 18/77 (23%), Positives = 34/77 (44%) Frame = +2 Query: 299 FSRLIEDIFHIHNKTDKITQLKDREKTRLFLNTMANITNSNSDKKQEELINDIIASINRI 478 FS L + + + +TDK+ ++ E + F+N A++ E + + R Sbjct: 143 FSILQQFVAIFNEETDKLVEVLKEECYKPFINVNAHVAQFTLKTIAETAMGTKLRFTTR- 201 Query: 479 KENITKGNTGVINEAIL 529 KE I K + + E +L Sbjct: 202 KETIYKQSIVDMGEFLL 218 >AY337337-1|AAP94192.1| 505|Tribolium castaneum cytochrome P450 monooxygenase protein. Length = 505 Score = 21.8 bits (44), Expect = 7.0 Identities = 18/77 (23%), Positives = 34/77 (44%) Frame = +2 Query: 299 FSRLIEDIFHIHNKTDKITQLKDREKTRLFLNTMANITNSNSDKKQEELINDIIASINRI 478 FS L + + + +TDK+ ++ E + F+N A++ E + + R Sbjct: 143 FSILQQFVAIFNEETDKLVEVLKEECYKPFVNVNAHVAQFTLKTIAETAMGTKLRFTTR- 201 Query: 479 KENITKGNTGVINEAIL 529 KE I K + + E +L Sbjct: 202 KETIYKQSIVDMGEFLL 218 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 160,787 Number of Sequences: 336 Number of extensions: 3293 Number of successful extensions: 11 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 11 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 11 length of database: 122,585 effective HSP length: 56 effective length of database: 103,769 effective search space used: 23244256 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -