BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= FWDP01_FL5_L09 (859 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_724| Best HMM Match : eIF-3c_N (HMM E-Value=0) 95 9e-20 SB_44315| Best HMM Match : M (HMM E-Value=2.2e-10) 31 1.2 SB_54665| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.2 SB_52819| Best HMM Match : E-MAP-115 (HMM E-Value=0.82) 30 2.8 SB_50709| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.8 SB_20481| Best HMM Match : Pox_A_type_inc (HMM E-Value=5.60519e-45) 29 4.8 SB_54| Best HMM Match : Actin (HMM E-Value=0) 29 6.4 SB_43487| Best HMM Match : K-box (HMM E-Value=0.79) 28 8.5 >SB_724| Best HMM Match : eIF-3c_N (HMM E-Value=0) Length = 564 Score = 94.7 bits (225), Expect = 9e-20 Identities = 50/87 (57%), Positives = 62/87 (71%) Frame = +1 Query: 301 FEELQKAYTRAAPVVQKEENGVAPRFFIRALVELDDWVVGAWNEREARKALSKGNSKALT 480 FE L KA+T+A VV KE G+ P FFIRAL EL+D+V W + E RK LSK N++AL Sbjct: 18 FENLGKAFTKAKAVVDKE--GIPP-FFIRALSELEDFVKENWEDAEGRKKLSKINARALA 74 Query: 481 SLRQKLRKYTKDFEAEISKFREDPDLP 561 +LRQKLRKY+KDFE +I K+RE P Sbjct: 75 TLRQKLRKYSKDFEDDIEKYRESIGQP 101 >SB_44315| Best HMM Match : M (HMM E-Value=2.2e-10) Length = 2155 Score = 31.1 bits (67), Expect = 1.2 Identities = 31/135 (22%), Positives = 59/135 (43%), Gaps = 6/135 (4%) Frame = +1 Query: 163 TFSDDEEETKRVVRSMKEKRYEELEGIIHSIRNHRKIKDFSSALASFEELQKAYTRAAPV 342 +F +++ + + M K Y ELE + +I + R +S+L E++ + A Sbjct: 214 SFREEKAKLDSSLMDMTAK-YAELEAQLETISHER-----TSSLGEMGEIKSEFDEATTT 267 Query: 343 VQKE--ENGVAPRFFIRALVELDDWVVGAWNEREARKA----LSKGNSKALTSLRQKLRK 504 + E A + F + + L + + E+E KA +S + T LRQ+ + Sbjct: 268 KESLSLELDKAKKNFEKIKIRLKNNIKSTREEKEKMKAEIEKISSEKHEICTKLRQEFEE 327 Query: 505 YTKDFEAEISKFRED 549 KD + +S RE+ Sbjct: 328 ALKDKDDVLSSLREE 342 >SB_54665| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 573 Score = 31.1 bits (67), Expect = 1.2 Identities = 28/104 (26%), Positives = 47/104 (45%), Gaps = 6/104 (5%) Frame = +1 Query: 160 YTFSDDEEETKRVVRSMKEKRY------EELEGIIHSIRNHRKIKDFSSALASFEELQKA 321 Y F DEEET+ VV +K++R + + S+ +D ++A S E L K Sbjct: 453 YDFESDEEETEEVVDKIKKRRSSRASAGDGTDDATESMDTSDATQD-TTATISEERLNKF 511 Query: 322 YTRAAPVVQKEENGVAPRFFIRALVELDDWVVGAWNEREARKAL 453 + V K P +R+ ++ D ++E+E +KAL Sbjct: 512 KSSLQQVFTKAHTQTLPLSDVRSAIDRDH-PRDKFSEQEFKKAL 554 >SB_52819| Best HMM Match : E-MAP-115 (HMM E-Value=0.82) Length = 883 Score = 29.9 bits (64), Expect = 2.8 Identities = 14/40 (35%), Positives = 24/40 (60%) Frame = +1 Query: 430 EREARKALSKGNSKALTSLRQKLRKYTKDFEAEISKFRED 549 ER A+ + NSK+ + R++ R+ D EAE+S R++ Sbjct: 791 ERMVSSAMRRLNSKSSAAKRRRRRRKHVDLEAEVSGLRQE 830 >SB_50709| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 953 Score = 29.1 bits (62), Expect = 4.8 Identities = 12/22 (54%), Positives = 15/22 (68%) Frame = +1 Query: 133 PVVRAPAPVYTFSDDEEETKRV 198 PV+R P PV + +D E TKRV Sbjct: 5 PVIRCPLPVNSNTDPERNTKRV 26 >SB_20481| Best HMM Match : Pox_A_type_inc (HMM E-Value=5.60519e-45) Length = 4160 Score = 29.1 bits (62), Expect = 4.8 Identities = 30/123 (24%), Positives = 55/123 (44%), Gaps = 4/123 (3%) Frame = +1 Query: 211 KEKRYEELEGIIHSIRN-HRKIKDFSSALASFEE-LQKAYTRAAPVVQKEENGVAPRFFI 384 KE+R +E+E + H +I+ + E+ + T+ V+Q+ ++ Sbjct: 3445 KEQRIQEIERELKVYETKHTEIRVYEEKYVEIEKRYYELETKYYTVIQEMKDATVDNDIT 3504 Query: 385 RALVE-LDDWVVGAWNEREARKALSKGNSKALTSLRQKLRKYTKDFEAEISKF-REDPDL 558 + +E L V E+E K +G+ T R++L++ D AEIS+ +E L Sbjct: 3505 KDELERLKKIVENDEKEKENLKRKLQGSDSDGTMERKRLQRDMSDARAEISRLEKEVKRL 3564 Query: 559 PDD 567 DD Sbjct: 3565 KDD 3567 >SB_54| Best HMM Match : Actin (HMM E-Value=0) Length = 2486 Score = 28.7 bits (61), Expect = 6.4 Identities = 22/74 (29%), Positives = 34/74 (45%) Frame = +1 Query: 139 VRAPAPVYTFSDDEEETKRVVRSMKEKRYEELEGIIHSIRNHRKIKDFSSALASFEELQK 318 V P+P + EE ++++ M K +ELE I R + K+ L EE Q+ Sbjct: 1058 VNEPSPFVKQTSVNEEEVKLLKEMFNKEQQELESRISLER--LRYKEEQQRLRDEEEQQR 1115 Query: 319 AYTRAAPVVQKEEN 360 A+ Q+EEN Sbjct: 1116 AWLEKK--FQREEN 1127 >SB_43487| Best HMM Match : K-box (HMM E-Value=0.79) Length = 243 Score = 28.3 bits (60), Expect = 8.5 Identities = 17/67 (25%), Positives = 34/67 (50%) Frame = +1 Query: 166 FSDDEEETKRVVRSMKEKRYEELEGIIHSIRNHRKIKDFSSALASFEELQKAYTRAAPVV 345 F E+E + + S++E+ E + HS+R R+ A+F++LQK VV Sbjct: 101 FHQREKEFAQEIASLQEENKE----LKHSLRLEREALSLEYDHANFDKLQKLIDELEDVV 156 Query: 346 QKEENGV 366 ++++ + Sbjct: 157 KRKKEAI 163 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 19,026,664 Number of Sequences: 59808 Number of extensions: 328045 Number of successful extensions: 1001 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 941 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 997 length of database: 16,821,457 effective HSP length: 81 effective length of database: 11,977,009 effective search space used: 2443309836 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -