BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= FWDP01_FL5_K21 (880 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value U41031-1|AAA82618.2| 562|Caenorhabditis elegans Abnormal cell l... 35 0.067 AF133217-1|AAD24877.1| 583|Caenorhabditis elegans tyrosine kina... 35 0.067 Z93387-4|CAI91177.1| 333|Caenorhabditis elegans Hypothetical pr... 30 2.5 Z93387-3|CAB07652.1| 352|Caenorhabditis elegans Hypothetical pr... 30 2.5 >U41031-1|AAA82618.2| 562|Caenorhabditis elegans Abnormal cell lineage protein 18 protein. Length = 562 Score = 35.1 bits (77), Expect = 0.067 Identities = 18/63 (28%), Positives = 32/63 (50%) Frame = +2 Query: 338 LKSSDLKILKAPVLSIKTQGRVPKTAKEFSIILPCVGNSSGVATFEIGLVLKNARGLPLK 517 ++S D +L P++ I +G VP++ ++F++ C G+ SG + K PLK Sbjct: 60 VESDDSSVL--PIVRIPLKGTVPESLQDFTVEYRCAGHRSGQFAVSLYFTFKYGNKEPLK 117 Query: 518 APL 526 L Sbjct: 118 VKL 120 >AF133217-1|AAD24877.1| 583|Caenorhabditis elegans tyrosine kinase receptor-relatedprotein precursor RYK protein. Length = 583 Score = 35.1 bits (77), Expect = 0.067 Identities = 18/63 (28%), Positives = 32/63 (50%) Frame = +2 Query: 338 LKSSDLKILKAPVLSIKTQGRVPKTAKEFSIILPCVGNSSGVATFEIGLVLKNARGLPLK 517 ++S D +L P++ I +G VP++ ++F++ C G+ SG + K PLK Sbjct: 81 VESDDSSVL--PIVRIPLKGTVPESLQDFTVEYRCAGHRSGQFAVSLYFTFKYGNKEPLK 138 Query: 518 APL 526 L Sbjct: 139 VKL 141 >Z93387-4|CAI91177.1| 333|Caenorhabditis elegans Hypothetical protein T02E9.2b protein. Length = 333 Score = 29.9 bits (64), Expect = 2.5 Identities = 15/44 (34%), Positives = 24/44 (54%) Frame = +2 Query: 299 VEIEEEILLQFDTLKSSDLKILKAPVLSIKTQGRVPKTAKEFSI 430 VE EEE + + D K++ +K +KAP + T T+ EF + Sbjct: 194 VEEEEEPIKKKDEGKTTHMKTVKAPAAASSTTAAAASTSTEFPV 237 >Z93387-3|CAB07652.1| 352|Caenorhabditis elegans Hypothetical protein T02E9.2a protein. Length = 352 Score = 29.9 bits (64), Expect = 2.5 Identities = 15/44 (34%), Positives = 24/44 (54%) Frame = +2 Query: 299 VEIEEEILLQFDTLKSSDLKILKAPVLSIKTQGRVPKTAKEFSI 430 VE EEE + + D K++ +K +KAP + T T+ EF + Sbjct: 213 VEEEEEPIKKKDEGKTTHMKTVKAPAAASSTTAAAASTSTEFPV 256 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 18,225,938 Number of Sequences: 27780 Number of extensions: 391811 Number of successful extensions: 1174 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 1063 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1174 length of database: 12,740,198 effective HSP length: 81 effective length of database: 10,490,018 effective search space used: 2213393798 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -